KEGG   Neurospora crassa: NCU09223Help
Entry
NCU09223          CDS       T01034                                 

Definition
protein disulfide-isomerase precursor
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ncr  Neurospora crassa
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ncr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 505 aa AA seqDB search
MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEESELCQQHGVEGYPTLKVFRGLEVVSPYKGQRKAAAITS
YMIKQSLPSVSELNKDNIEEFKKADKVVIVAYLDAADKASNETFSKVADKLRDEYPFGAS
SDAALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDPEAIEKFAKTASTPLIGEVGPDTYAG
YMSAGIPLAYIFAETPEERKELSEALKSIAEAQRGVINFATIDAKAFGAHAGNLNLKADK
FPAFAIQDTTKNLKFPFDQEKEITADSIKKFVDDFVAGKVEPTIKSEPIPETQEGPVTVV
VAKSYDDIVLDDTKDVLIEFYAPWCGHCKALAPKYDELATLYANSDFKDKVVIAKVDATQ
NDVPDEIQGFPTIKLYAAGAKDKPVEYSGPRTVEDLIKFISENGKYKASPPAEAEESVAA
SAESGSSTETGTVEEPAKETSHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacctaccaagtttgccctcgggcttctcgcggcggccgccgtggccactgcc
tccgatgttatccagttgaagaaggacaccttcgatgacttcgtcaaaaccaacgacatt
gttcttgctgaattcttcgcaccttggtgcggccactgcaaggcccttgcccccgaatac
gaggaggctgctaccaccctcaaagagaagaacatcaagctcgctaagatcgattgcact
gaggagtccgagttgtgccagcagcacggcgtcgagggctaccctaccctcaaggtcttc
cgtggcctcgaagtcgtctccccctacaagggccagcgcaaggctgctgccatcacttcc
tatatgatcaagcagtctcttccctccgtctccgaactcaacaaggacaacattgaggag
ttcaagaaggccgacaaggtcgtcattgttgcctacctcgatgccgccgacaaggcctcc
aacgagaccttctccaaggtcgccgataagctccgcgacgagtaccccttcggtgccagc
agtgatgctgctctcgccgaggctgagggtgtcaccgcccctgccatcgttctctacaag
gattttgatgagggtaaggccgttttcactgagaagttcgaccccgaggccattgagaag
tttgccaagactgcctccacccccctcatcggtgaggttggccccgacacctatgccggc
tacatgtccgctggcatccccctcgcctacatctttgccgagacccccgaagagcgcaag
gagcttagcgaggccctcaagtccatcgctgaggcccagcgtggtgtcatcaacttcgct
accattgacgccaaggctttcggtgctcatgccggcaacctgaacctcaaggccgacaag
ttccccgccttcgctatccaggacaccaccaagaacctaaagttccccttcgaccaggag
aaggagattaccgccgactccatcaagaagttcgttgatgacttcgttgctggcaaggtc
gagcccacgatcaagtctgagcccatccccgagacccaggagggccccgttactgtcgtc
gtcgccaagagctacgacgacattgtccttgacgacaccaaggatgttcttatcgagttc
tacgctccctggtgcggtcactgcaaggctctcgctcccaagtacgatgagcttgctacc
ctctatgccaactcggatttcaaggacaaggttgtcattgccaaggttgatgctacccag
aacgacgttcccgatgagatccagggcttccccaccatcaagctctacgctgccggtgcc
aaggacaagcccgtcgagtactctggcccccgcaccgttgaggatttgatcaagttcatc
tccgagaacggcaagtacaaggcttctcccccggctgaggctgaggaatccgttgccgct
tccgccgagtctggttcctccaccgagactggcaccgtcgaggagcccgccaaggagacc
agccacgacgagctctaa

DBGET integrated database retrieval system