KEGG   Neurospora crassa: NCU09223Help
Entry
NCU09223          CDS       T01034                                 

Definition
protein disulfide-isomerase precursor
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ncr  Neurospora crassa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCU09223
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCU09223
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCU09223
  Exosomal proteins of colorectal cancer cells
   NCU09223
  Exosomal proteins of bladder cancer cells
   NCU09223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 505 aa AA seqDB search
MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEESELCQQHGVEGYPTLKVFRGLEVVSPYKGQRKAAAITS
YMIKQSLPSVSELNKDNIEEFKKADKVVIVAYLDAADKASNETFSKVADKLRDEYPFGAS
SDAALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDPEAIEKFAKTASTPLIGEVGPDTYAG
YMSAGIPLAYIFAETPEERKELSEALKSIAEAQRGVINFATIDAKAFGAHAGNLNLKADK
FPAFAIQDTTKNLKFPFDQEKEITADSIKKFVDDFVAGKVEPTIKSEPIPETQEGPVTVV
VAKSYDDIVLDDTKDVLIEFYAPWCGHCKALAPKYDELATLYANSDFKDKVVIAKVDATQ
NDVPDEIQGFPTIKLYAAGAKDKPVEYSGPRTVEDLIKFISENGKYKASPPAEAEESVAA
SAESGSSTETGTVEEPAKETSHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacctaccaagtttgccctcgggcttctcgcggcggccgccgtggccactgcc
tccgatgttatccagttgaagaaggacaccttcgatgacttcgtcaaaaccaacgacatt
gttcttgctgaattcttcgcaccttggtgcggccactgcaaggcccttgcccccgaatac
gaggaggctgctaccaccctcaaagagaagaacatcaagctcgctaagatcgattgcact
gaggagtccgagttgtgccagcagcacggcgtcgagggctaccctaccctcaaggtcttc
cgtggcctcgaagtcgtctccccctacaagggccagcgcaaggctgctgccatcacttcc
tatatgatcaagcagtctcttccctccgtctccgaactcaacaaggacaacattgaggag
ttcaagaaggccgacaaggtcgtcattgttgcctacctcgatgccgccgacaaggcctcc
aacgagaccttctccaaggtcgccgataagctccgcgacgagtaccccttcggtgccagc
agtgatgctgctctcgccgaggctgagggtgtcaccgcccctgccatcgttctctacaag
gattttgatgagggtaaggccgttttcactgagaagttcgaccccgaggccattgagaag
tttgccaagactgcctccacccccctcatcggtgaggttggccccgacacctatgccggc
tacatgtccgctggcatccccctcgcctacatctttgccgagacccccgaagagcgcaag
gagcttagcgaggccctcaagtccatcgctgaggcccagcgtggtgtcatcaacttcgct
accattgacgccaaggctttcggtgctcatgccggcaacctgaacctcaaggccgacaag
ttccccgccttcgctatccaggacaccaccaagaacctaaagttccccttcgaccaggag
aaggagattaccgccgactccatcaagaagttcgttgatgacttcgttgctggcaaggtc
gagcccacgatcaagtctgagcccatccccgagacccaggagggccccgttactgtcgtc
gtcgccaagagctacgacgacattgtccttgacgacaccaaggatgttcttatcgagttc
tacgctccctggtgcggtcactgcaaggctctcgctcccaagtacgatgagcttgctacc
ctctatgccaactcggatttcaaggacaaggttgtcattgccaaggttgatgctacccag
aacgacgttcccgatgagatccagggcttccccaccatcaagctctacgctgccggtgcc
aaggacaagcccgtcgagtactctggcccccgcaccgttgaggatttgatcaagttcatc
tccgagaacggcaagtacaaggcttctcccccggctgaggctgaggaatccgttgccgct
tccgccgagtctggttcctccaccgagactggcaccgtcgaggagcccgccaaggagacc
agccacgacgagctctaa

DBGET integrated database retrieval system