KEGG   Neurospora crassa: NCU09332Help
Entry
NCU09332          CDS       T01034                                 

Definition
similar to mannosyltransferase PMTI
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ncr  Neurospora crassa
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ncr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 774 aa AA seqDB search
MASTTATPEATLRQRNVPASSKKAKNGVSSDVETDKVPDAVAPAKSGSELEYKLALILIT
GLAFLTRFWGISHPDEVVFDEVHFGKFASYYLERTYFFDVHPPFGKLLFAFMGWLVGYDG
HFHFENIGDSYIRNKVPYVAFRSLPAILGALTVSVVYMIMWESGYSLPACLIAAGLVLLD
NAHIGQTRLILLDATLVFAMACSLLCYIKFHKLRHEPFSRKWWKWLILTGFALSCDISTK
YVGLFAFITIGSAVCIDLWDLLDIKRPGGALTLPQFGKHFAARAFGLIIMPFIFYLFWFQ
VHFSILTRSGPGDDFMTPEFQETLSDNIMLANAVTIDYYDTISIRHKETKAYLHSHPDKY
PLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPPGPDDQKLGHPIKNHDLVRLRHIVTDTI
LLSHDVASPYYPTNQEFTTVSIGDAYGDRAADTLFEIRIEHGKANQEFKSISSHFKLIHN
PSKVAMWTHSKPLPEWGHKQQEINGNKQLAQSSNVWLVEDIVSLPADHARREKPEKKVKT
LPFLRKWFELQRSMFWHNNQLTSSHPYASLPYQWPFLLRGVSFWTQNDTRQQIYFLGNPI
GWWLASSVLAIYAGIILADQFSLRRGLDAMDRRTRSRLYNSTGFFFLAWATHYFPFFVMG
RQLFLHHYLPAHLASALVTGSVVEFLFSTDSAEPEYQPSKSGKKVAPTTKRRLSARERLA
GQSMAGAWIATAVIMVLVAFGWYFFLPLTYGYPGLTAPEVNRRKWLGYDLHFAK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcctccacaacagcaacccccgaggccactctacgccagaggaacgtgccagcctcg
agtaagaaagccaagaatggcgtttcctcagatgtcgaaaccgacaaggttccggatgcc
gtcgctccagccaaatccggctccgaactcgaatataaacttgctcttatcctcatcacc
ggcttggcgttccttaccagattctggggcatcagccatcccgatgaggtcgtgttcgac
gaagtccattttggaaagttcgcgtcctattatctcgagagaacatacttttttgatgta
caccctccctttggcaagcttctctttgccttcatgggctggttggtcggctatgatggc
cacttccacttcgagaacattggcgattcttacatccgcaacaaggtcccttatgtcgcc
tttcgctctcttcccgccattctcggtgccctcaccgtttcggttgtctatatgatcatg
tgggagtcgggttatagccttccagcttgtctgattgccgccggtcttgtcctgctcgac
aacgctcacattggccagactcgcctgattctcctcgatgccaccctggtctttgctatg
gcgtgcagcttgctctgctatatcaagttccacaagctgaggcacgagcccttctccagg
aagtggtggaaatggctgatcctgactggcttcgccctttcttgcgatatctccactaag
tatgttggcctcttcgccttcatcacgattggttctgccgtatgcatcgacttgtgggat
cttttggacatcaagcgtcccggtggcgctctgactctgccccagtttggcaagcacttt
gcggctagggcttttgggttgatcattatgcccttcatcttttacctcttctggttccag
gttcacttctcgatcctcactcgctctggacctggcgatgactttatgacccccgagttc
caggagaccctcagtgacaacatcatgctcgccaacgccgtcaccattgattactatgac
accatcagcatcaggcacaaggagaccaaggcctaccttcacagccacccggacaagtac
ccgctgagatatgacgatggccgtgtgtctagccagggtcaacaggtgactggctaccct
ttcaacgataccaacaactactggcagatccttccccctggccctgacgatcagaagctc
ggtcatcccatcaagaaccatgatctcgtgaggcttcgccacattgttacggataccatc
ctgctctctcacgatgttgcttctccttactatcctaccaaccaagaattcaccaccgtc
tccattggagatgcctacggcgaccgcgcggctgatactctctttgagatccgtatcgag
catggaaaggccaaccaggaattcaagagtatttccagccacttcaagctgatccacaac
cccagcaaggttgccatgtggactcactcgaagccactcccggaatggggtcacaagcaa
caggagatcaacggtaacaagcaactggcacagagctccaacgtctggcttgttgaggac
attgtgtctctgcccgcggatcacgcgcgccgtgagaagcctgagaagaaggtcaagact
cttccgttcctgcgcaagtggttcgagctgcagcggtcgatgttctggcacaacaaccag
ctcaccagtagccatccctatgcctctctgccgtaccagtggccttttctattgcgtggc
gtgagcttctggacgcagaacgatactcgccagcagatctacttccttggtaatcccatc
ggatggtggctcgctagcagtgtcttggctatctatgccggcattatcctggcggatcag
ttctcgctccgccgtgggctcgacgccatggatcgtcgtacccgatcccgcttgtacaac
tctacaggtttcttcttcctcgcctgggcaactcactacttccccttcttcgtcatgggc
cgtcagctcttcttacatcattatctaccggctcaccttgcttcggcacttgttactggc
tcggtggtggagttcctcttcagcaccgactcagcggagcctgagtaccagcccagcaag
tcgggtaagaaggtcgctcctaccaccaagcgccgcttgagtgcccgcgagcgtcttgct
ggccagagcatggctggcgcctggatcgcgactgctgtcatcatggtccttgtcgccttt
ggctggtacttcttcctgcccttgacctacggatatcctgggttgaccgctcccgaggtt
aaccggaggaagtggctgggctacgaccttcacttcgccaagtag

DBGET integrated database retrieval system