KEGG   Neurospora crassa: NCU09534Help
Entry
NCU09534          CDS       T01034                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ncr  Neurospora crassa
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NCU09534
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU09534
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCU09534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group V; V
AA seq 229 aa AA seqDB search
MIPRYHHRSVATLARTSLTTRHLKLSPILPQQQQQQPRLPVSKPAFRCQPAISRRFATTT
LNMSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEK
YPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKN
EKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELGE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgataccccgctaccatcatcgctcagtagctacacttgctcgcacctcactcaccact
cgtcatttgaaactatcaccgattctacctcaacaacaacaacaacaacctcgactgcca
gtttccaaaccagcattccgttgccagccagccatttccagacgcttcgcaacaaccaca
cttaacatgtcttctgccactactatctacgactttaagccccttgacaagaagggctcc
gaactccccctctccacctaccaaggcaaggtagtcctgatcgtcaacgttgcctccaaa
tgcggtttcacgcctcaatacgccggcctggaaaaggtctacaaggagatcaaggagaag
tacccggacgattttgagatcctcgctttcccttgcaaccagttcggcggacaggagccg
ggcaccgaggaggagatccagtcgttctgccagctcaactatggcgtttccttccccatc
atgaagaaggtggaggtcaacggcgacaatgctgatcccctctatgaatggatgaagaat
gagaagcctggcctgatgggattgaagagaatcaagtggaactttgaaaagttcttgatt
ggaaaggatggaaaggtcaagggacggtgggcgagcactacgaagcctgagtctctgaag
gaggctatccttaaggagttgggcgagtaa

DBGET integrated database retrieval system