KEGG   Neurospora crassa: NCU09741Help
Entry
NCU09741          CDS       T01034                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NCU09741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 692 aa AA seqDB search
MAELDTLDLVVLAAILLGTVAYFTKGKLWGVTKDPYASSLANASGAKAGKTRNIVEKMEE
QGKNCIIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEEYDFDNLDTIPDDKVVFFV
LATYGEGEPTDNAVDFYEFITNEDVNFTEGNEPALGNLNYVTFGLGNNTYEHYNSMVRNV
DKALQKLGAHRIGDAGEGDDGAGTMEEDFLAWKEPMWKALAERMGLEEREAVYEPVFSII
EREGLTKESPEVYLGEPNKMHLDGTAKGPFNAHNPYIAPIAQSYELFSVKDRNCLHMDID
ISASNLNYQTGDHIAVWPTNPGEEVDRFMNVLGLSEKRHTVVSVKALEPTAKVPFPTPTT
YDAIVRYHMEICAPVSRQFLAQLAAFAPDAEARAEMTKLGAEKDYFYEKISLHHLNIARV
LDIVGKGQKWTNIPFSAFIEGITKLQPRYYSISSSSLEQPKTISITAVVENTQLPGRDDP
FRGVATNYLLALKQKQNGEPEPCPFGLSYELTGPRNKYDGIHVPVHVRHSNFKLPSDPSK
PIICIGPGTGVAPMRGFIRERVQQAKNGEKVGKTLLFFGCRKSTEDFMYKNEWEEAKEIL
GDNFELITAFSREGPKKVYVQHRLKERAEEINQLLEQKAYFYVCGDAANMAREVNTVLSQ
IISEQRGIPEAKAEEIVKNMRSSNQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactcgacacgctggacctcgtggtcctggcggccatccttctcggaacggtc
gcctacttcacaaaaggcaaactgtggggcgttacaaaggatccttatgcgagctctctg
gccaatgccagcggcgcaaaggctggcaagacaagaaacattgtggagaagatggaggag
cagggcaagaactgcatcattttctacggatctcaaaccggtactgctgaggattatgct
tcaagactggccaaggagggcaagagccggttcggccttgaaaccatggttgctgacctt
gaggaatacgacttcgacaatcttgataccattcctgacgacaaggtggtgttcttcgta
ctcgccacctatggtgagggtgagcctactgataacgctgtggatttctacgagttcatc
accaacgaagacgtcaacttcacggagggcaacgaacccgcgcttggcaacctgaactat
gtcacgttcggtctcggaaacaacacctatgagcactacaactccatggttcgcaatgtg
gacaaggctctccagaagctgggtgcccaccgtatcggagatgctggcgagggtgatgat
ggcgctggtaccatggaagaagatttcttggcctggaaggaacccatgtggaaggctctc
gccgagaggatgggtttggaggagcgcgaggccgtttacgagcccgtcttcagcatcatc
gaaagggagggcctgaccaaggagtcccctgaagtctatctcggtgaacccaacaagatg
catctcgacggaaccgccaagggccccttcaacgcccacaacccgtacatcgctcccatc
gcccagtcctacgagctcttctccgtcaaggaccgcaactgtctccacatggatatcgat
atcagcgcctctaacctcaactaccagactggtgaccacatcgctgtttggcccacgaac
cctggtgaggaggtcgatcgcttcatgaacgtcctgggtctttccgaaaagcgccacact
gttgtcagcgtcaaggctctcgagcctaccgccaaggttcccttcccgactcccaccacc
tacgacgctatcgttcgctaccacatggaaatctgcgctcccgtgtctcgtcaattcctc
gcccaactcgctgcttttgctcccgatgcggaggcaagggccgagatgaccaagctcggc
gccgaaaaggattacttctacgagaagatcagtcttcaccatctcaacattgccagagtc
ttggatattgttggcaagggtcagaaatggaccaacatccccttctctgcttttattgag
ggtatcaccaagcttcagccccgctactactccatctcgtcctcatcccttgaacagccc
aagacgatttccatcactgccgttgtcgaaaatacccagcttcctggtcgtgatgacccc
ttccgcggtgttgccaccaactacctcctcgcgctcaaacagaagcagaacggcgagccc
gaaccttgcccttttggtctttcctacgaactcactggcccccgtaacaagtacgatggt
atccacgtccccgttcatgtccgccactccaacttcaagctcccctcggatccatccaag
cccatcatctgcattggtcccggtactggtgtagcgcccatgcgtggcttcatccgtgag
cgcgtgcagcaggccaagaacggcgagaaggttggcaagactctgctcttctttggctgt
cgcaagtctaccgaggacttcatgtacaagaacgaatgggaggaagccaaggagatcctc
ggcgacaacttcgagctcatcaccgccttctcccgcgagggccccaagaaggtctacgtc
cagcaccgtctcaaggaaagggccgaggagatcaaccagcttctcgagcaaaaggcctac
ttctacgtctgcggcgacgctgccaacatggcgcgcgaggtcaacaccgttctgagccag
atcatttccgaacaacgaggcatccccgaggccaaggccgaggagattgtcaagaacatg
aggtcatcgaatcagtaccaggaggatgtctggtcataa

DBGET integrated database retrieval system