KEGG   Neurospora crassa: NCU09930Help
Entry
NCU09930          CDS       T01034                                 

Definition
similar to folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 471 aa AA seqDB search
MTDAIDLPASSKPAAPTVRTAYIALGSNLGDRIGWIEKACKEMDARGIKVKRTSCLWETE
PMYVLDQDRFVNGACEVETTLEPLELLDALQDIENSLGRKKIIDKGPRNIDLDILLYENL
KVDHERLKIPHIGIPEREFVLRPLAELIPDKPLDHTRPWTLTRDLLDALPPSSTPITTMT
PLSSHGHPPIQALNPSRKTHVMAILNMTPDSFSDGGQHASAGLESTIQSFLDAGATMIDV
GGQSTAPRTPQVSAEEEIGRVVPAIKMIREKFSHRDVLISVDTYRASVAEAAVAAGADIV
NDVSGGSMDPDMLPTVARLGSTICLMHMRGTPANMSSLNEYPEAEGGLIGGIAKELVGRV
AAAEAAGIRRWRIVLDPGLGFAKVGPQNVDVLRHLEELRSWPGLQGLPWLVGSSRKSFIG
QVTGVPTPKERIWGTAATVAAAVQGGADVVRVHDVKEMAQVVAMADAIWRY
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcaattgacctaccggcttcctccaagcccgccgcccccactgtgcgcact
gcttatatcgccctgggcagcaacctcggcgacaggataggatggatcgagaaggcttgc
aaggagatggatgcccgcggtatcaaggttaagcggaccagttgtctgtgggagacggag
cccatgtacgtcttagaccaggatagatttgtcaatggagcatgcgaggttgaaactact
ctagagcctcttgagcttctagacgcacttcaggatattgaaaactccctaggtcgcaag
aagattatcgacaagggaccccgtaacatcgacctcgacattcttctctacgaaaacctc
aaagtcgaccatgaacgtctcaagatccctcatatcggcattcctgagcgcgagttcgtc
ctcaggcccttagcagaactcattcctgacaaacccctcgaccacacccgcccctggacc
ctcacccgcgacctcctcgacgccctgcccccctcctctacccccatcaccaccatgacc
cctctctcctcccacggccacccgcccatccaagccctcaacccctcgcgcaagacgcac
gtcatggccatcctcaacatgacgcccgactccttctccgacggcggccagcacgcctcc
gccggtctcgaatccaccatccaatccttcctcgacgcaggcgccaccatgatcgacgtc
ggcgggcagtccacggcgcctcgcacgccgcaggtttccgccgaggaagagatcggccgc
gtggttcccgccatcaaaatgatccgcgaaaagttttcgcaccgcgacgtgctcatcagc
gtcgacacgtaccgggcgtcggtagcggaggccgcggtcgccgcaggtgcggatatcgtg
aacgatgtgtccggaggtagcatggatccggacatgctgccgactgttgcgcgcctggga
agcaccatttgcttgatgcacatgcgcggaacgccggccaacatgtcgagcctcaatgag
taccccgaagcggagggcgggttgattggggggatcgccaaggagctggtgggtagggtg
gcggctgccgaggcggcgggcatcaggcgctggaggatcgtgctggatccggggttgggg
ttcgcaaaggtgggaccgcagaatgtggatgtgttgaggcacttggaggagttgaggagc
tggcctggcttgcaggggttgccgtggctggtgggctcgagtagaaagagcttcattggg
caggtgacgggagtaccgactcccaaggagaggatttggggcacggcggcgacggtcgcg
gctgcggtgcagggtggagcggacgtggtgagagtgcatgatgtcaaggagatggcgcag
gtggttgctatggctgatgctatttggaggtattaa

DBGET integrated database retrieval system