KEGG   Neurospora crassa: NCU09930Help
Entry
NCU09930          CDS       T01034                                 

Definition
(RefSeq) folic acid synthesis protein
  KO
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCU09930
Enzymes [BR:ncr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NCU09930
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NCU09930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group IV; IV
AA seq 548 aa AA seqDB search
MKRFPTISSSTRPLTCRHRLLTKRLIFTGNTQLTTTSLPRTPQLSTTTPKPARTFHSAST
HLSALSFKKYTLPPKAKMTDAIDLPASSKPAAPTVRTAYIALGSNLGDRIGWIEKACKEM
DARGIKVKRTSCLWETEPMYVLDQDRFVNGACEVETTLEPLELLDALQDIENSLGRKKII
DKGPRNIDLDILLYENLKVDHERLKIPHIGIPEREFVLRPLAELIPDKPLDHTRPWTLTR
DLLDALPPSSTPITTMTPLSSHGHPPIQALNPSRKTHVMAILNMTPDSFSDGGQHASAGL
ESTIQSFLDAGATMIDVGGQSTAPRTPQVSAEEEIGRVVPAIKMIREKFSHRDVLISVDT
YRASVAEAAVAAGADIVNDVSGGSMDPDMLPTVARLGSTICLMHMRGTPANMSSLNEYPE
AEGGLIGGIAKELVGRVAAAEAAGIRRWRIVLDPGLGFAKVGPQNVDVLRHLEELRSWPG
LQGLPWLVGSSRKSFIGQVTGVPTPKERIWGTAATVAAAVQGGADVVRVHDVKEMAQVVA
MADAIWRY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattcccaaccatctcctcctcgaccaggccattgacctgtcggcataggctt
ctgacaaaacgattgattttcaccggcaacacacaactaaccacaacatcattaccacgc
acaccacaactctcaaccaccactccgaaaccggcacgcacttttcactcggcctccact
cacctttcagcattgtcgttcaaaaagtacacgctgcctcccaaggccaaaatgacagac
gcaattgacctaccggcttcctccaagcccgccgcccccactgtgcgcactgcttatatc
gccctgggcagcaacctcggcgacaggataggatggatcgagaaggcttgcaaggagatg
gatgcccgcggtatcaaggttaagcggaccagttgtctgtgggagacggagcccatgtac
gtcttagaccaggatagatttgtcaatggagcatgcgaggttgaaactactctagagcct
cttgagcttctagacgcacttcaggatattgaaaactccctaggtcgcaagaagattatc
gacaagggaccccgtaacatcgacctcgacattcttctctacgaaaacctcaaagtcgac
catgaacgtctcaagatccctcatatcggcattcctgagcgcgagttcgtcctcaggccc
ttagcagaactcattcctgacaaacccctcgaccacacccgcccctggaccctcacccgc
gacctcctcgacgccctgcccccctcctctacccccatcaccaccatgacccctctctcc
tcccacggccacccgcccatccaagccctcaacccctcgcgcaagacgcacgtcatggcc
atcctcaacatgacgcccgactccttctccgacggcggccagcacgcctccgccggtctc
gaatccaccatccaatccttcctcgacgcaggcgccaccatgatcgacgtcggcgggcag
tccacggcgcctcgcacgccgcaggtttccgccgaggaagagatcggccgcgtggttccc
gccatcaaaatgatccgcgaaaagttttcgcaccgcgacgtgctcatcagcgtcgacacg
taccgggcgtcggtagcggaggccgcggtcgccgcaggtgcggatatcgtgaacgatgtg
tccggaggtagcatggatccggacatgctgccgactgttgcgcgcctgggaagcaccatt
tgcttgatgcacatgcgcggaacgccggccaacatgtcgagcctcaatgagtaccccgaa
gcggagggcgggttgattggggggatcgccaaggagctggtgggtagggtggcggctgcc
gaggcggcgggcatcaggcgctggaggatcgtgctggatccggggttggggttcgcaaag
gtgggaccgcagaatgtggatgtgttgaggcacttggaggagttgaggagctggcctggc
ttgcaggggttgccgtggctggtgggctcgagtagaaagagcttcattgggcaggtgacg
ggagtaccgactcccaaggagaggatttggggcacggcggcgacggtcgcggctgcggtg
cagggtggagcggacgtggtgagagtgcatgatgtcaaggagatggcgcaggtggttgct
atggctgatgctatttggaggtattaa

DBGET integrated database retrieval system