KEGG   Neurospora crassa: NCU10007Help
Entry
NCU10007          CDS       T01034                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ncr  Neurospora crassa
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU10007
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCU10007
   00630 Glyoxylate and dicarboxylate metabolism
    NCU10007
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCU10007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 542 aa AA seqDB search
MASVETLLQGVTISGPIEEHQRKILTPQALSFVALLHRSFNQTRKNLLERRQLRQAEIDR
GVLPDFLPETKHIRENPTWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVYTYMADFE
DSSAPTWANMVNGQVNLYDAIRRQIDFKQGPKEYKLRTDRTLPTLIVRPRGWHLEEKHVT
IDGEPVSGSLFDFGLYFFHNAKELVQRGFGPYFYLPKMESHLEARLWNDAFNLAQDYVGI
PRGTIRGTVLIETILAAFEMDEIIYELREHSSGLNCGRWDYIFSTIKKFRNHSSFVLPDR
SCVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKDDKAANDKAMEGVRADKLREA
RAGHDGTWVAHPALASIALEVFNKHMPTPNQLFNRREDVKIGQQDLLNMNVPGSITEEGI
RKNLNIGLGYMEAWIRGVGCVPINYLMEDAATAEVSRSQLWQWVKHGVTTAEGKRVDKSY
ALKLLKEQTDELASKAPQGNKFNLAAQYFATQVTGEDYADFLTSLLYNEITSAGNSLPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtcgagactcttctccagggcgtcaccatcagcggccccattgaggagcac
cagaggaagatcctgactccccaggccctctccttcgtcgccctcctccaccgttccttc
aaccagacccgcaagaacctcctcgagcgccgtcagctccgccaggccgagatcgaccgc
ggtgtcctccccgacttcctccccgagaccaagcacatccgtgagaaccccacatggaag
ggtgcgcctcccgctcccggtctcgtcgaccgccgcgtcgagatcaccggtcccaccgac
cgcaagatggtcgtcaacgctctcaactccgatgtctacacctacatggccgacttcgag
gactccagcgcccctacctgggccaacatggtcaacggccaggtgaacctctacgatgct
atccgtcgccagatcgacttcaagcaaggcccgaaggaatacaagctccgcaccgacagg
actcttcccaccctcatcgtccgccctcgtggctggcaccttgaggagaagcacgtcacc
attgacggcgagcccgtcagcggttcgcttttcgactttggtctttacttcttccacaac
gccaaggagctcgtccagcgcggcttcggcccctacttctacctccccaagatggagtct
caccttgaggcccgtctgtggaacgacgccttcaacctcgcccaggactacgttggcatt
ccccgcggcaccatccgtggtaccgtcctgatcgagaccattctcgccgccttcgagatg
gacgagatcatctacgagctccgcgagcactcctccggtcttaactgcggccgttgggat
tatatcttctccaccatcaagaagttccgcaaccactcctccttcgtcctccccgaccgc
tcctgcgtcaccatgaccgttcccttcatggacgcctacgtcaagctcctcatccagacc
tgccacaagcgtggtgtccacgccatgggcggcatggccgctcagatccccatcaaggac
gacaaggccgccaacgacaaggccatggagggcgttcgcgccgacaagctccgtgaagcc
cgtgccggccacgacggtacctgggttgctcaccccgcccttgccagcattgcccttgag
gtcttcaacaagcacatgcctacccccaaccagctcttcaaccgccgtgaggacgtcaag
attggccagcaggacctgctcaacatgaacgtccccggctcgatcaccgaggagggtatc
cgcaagaacctcaacattggtctcggttacatggaggcctggatccgtggtgtcggttgc
gtccccatcaactacctcatggaggatgccgccaccgccgaggtttcccgctcccagctc
tggcagtgggtcaagcacggcgtcaccaccgccgagggcaagcgcgtcgacaagtcgtac
gccctcaagcttctcaaggagcagaccgacgagctcgcctccaaggctccccagggtaac
aagttcaaccttgccgctcagtacttcgccacccaggtgactggcgaggactatgccgac
ttcttgacctccctcctttacaacgagattaccagtgctggtaactcgttgcctgcttcc
aagctctaa

DBGET integrated database retrieval system