KEGG   Neurospora crassa: NCU10045Help
Entry
NCU10045          CDS       T01034                                 

Definition
pectinesterase precursor
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ncr  Neurospora crassa
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCU10045
   00500 Starch and sucrose metabolism
    NCU10045
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     NCU10045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 333 aa AA seqDB search
MKSLLLPLLSLLSLSSSALAATRISPPSTACLRVGAGQPYSNIQSAVNALSTTASGSQCI
FIYPGTYWEQVLIPARSAQLSIYGYTANSQGYASNTVTIIANKSQADGLSNDQTATVRVK
SSNTRLYNLNIENAHGQGSQAVALSVAANGVGVYGCQLKGFQDTLLAEDGAQLYARTLIQ
GATDFIFGQRAPAWFEKCDIKVMAANLGYITALGRDSSSNPANYVFNSCSIAAAAGNNVP
SGAYYLGRPWRQFARVTFQKTSMTNVINPAGWSIWQNGDARTSNVEFGEYANTGAGASGV
RAWFGKLLGSPVKIESVLGSRYSRQGYYDASYM
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccttctcctcccgcttctctccctcctctccctctcctcctccgccctcgcc
gccacccgcatctcccctccttccaccgcctgtctccgcgtcggcgccggccaaccgtac
tcgaacatccaatccgccgtcaacgccctctccaccacggcttccgggtctcagtgcatc
ttcatttaccccggcacctactgggaacaggtcctgatcccggctcgctccgcccagctc
tccatctacggatacactgccaacagccaaggctatgcttccaacaccgtcaccatcatc
gccaacaagtcccaggccgatggcctaagcaacgaccagacggctactgtgcgcgtcaag
agcagcaacactcgcttgtataacctcaacattgagaatgcccacggccagggcagccaa
gccgtggcgctgagcgtggccgccaacggcgtgggcgtgtacggatgccagttgaaggga
ttccaggatacgctgctggcggaggacggagcgcagctgtatgcccggacgttgattcag
ggagccacggacttcatctttggacagcgcgcaccggcgtggtttgagaagtgcgatatc
aaggtcatggctgctaatcttgggtatatcaccgccttgggtcgtgattcatccagcaac
ccagccaactacgtcttcaacagctgctccatcgccgccgctgccggtaacaatgtgcct
tcgggagcctactacctcggtcgtccttggcgccaattcgctcgcgtcaccttccagaag
accagcatgaccaacgtgatcaaccctgctggttggtcgatctggcagaacggcgatgcg
aggaccagcaacgttgagtttggcgagtacgctaataccggtgcgggtgcgagcggagtc
agggcgtggtttggtaagctgttgggttcccccgtcaagattgagtcggtgctggggagt
cgttactctcgtcagggctactatgatgctagctatatgtaa

DBGET integrated database retrieval system