KEGG   Neurospora crassa: NCU10106Help
Entry
NCU10106          CDS       T01034                                 

Definition
(RefSeq) mitochondrial triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ncr  Neurospora crassa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU10106
   01230 Biosynthesis of amino acids
    NCU10106
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU10106
   00051 Fructose and mannose metabolism
    NCU10106
   00562 Inositol phosphate metabolism
    NCU10106
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCU10106
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCU10106
  Exosomal proteins of bladder cancer cells
   NCU10106
  Exosomal proteins of melanoma cells
   NCU10106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group IV; IV
AA seq 300 aa AA seqDB search
MSSASPSRERRRLVGVSTKMYFSHARTTNFITSFLDLMQHHTSTKTEQSNDNRNNLAAAL
ASKIDIFIIPDHLSLQSAINRTANHPSQSGPTDPKILFGAQNCHWEDSGPFTGEVSPAVL
AEVGCSIVELNHAERRRHFAETDAITCLKAQAVIRNGMIPLICVGEGSPGQIPALSEVAI
MKAAAEVVDQVELCLEGVDPTKEVWLAYEPVWAIGAKEPAGVEHVRGVVRTIRKSEVVRG
REERGGVTRILYGGSAGPGLFGQLKEVDGVDGLFLGRFAHEEGQFWKTICEVAEVEWEGR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgcatcaccttcccgtgagcgccggcgtctagtaggcgtctcaacaaaaatg
tacttctcccacgcccgcaccaccaacttcatcacctccttcctcgacctcatgcaacac
cacacctccaccaaaaccgagcagtccaacgacaacagaaacaacctggctgccgccctc
gcctccaagattgacatattcatcatccccgaccacctctctttgcagtctgccatcaac
cgcaccgccaaccacccaagtcaatctggcccaactgatcccaaaatcctcttcggcgcg
caaaactgccactgggaagattccggtccgttcacaggcgaggtatctcccgccgtcctg
gccgaggtagggtgcagcatagttgaactcaaccacgctgaacggcgccgccactttgcc
gaaacagatgccatcacctgcctcaaagctcaggcagtcatacgaaacgggatgatcccc
ctcatctgcgttggcgaaggctcccctggtcaaatacctgccttgagcgaggtagcaatc
atgaaagcggcggcggaggtggtcgaccaagtagaactttgcctagagggcgttgacccc
acaaaagaagtttggctggcttacgaacctgtttgggctattggtgcaaaggagcctgcg
ggggtggaacatgtgaggggggtggtgaggactatacgaaaaagtgaggtggtgaggggg
agggaggaaaggggcggggtgacgaggattttgtatggagggagcgcggggccggggttg
tttggacaactgaaagaggttgatggagtagatgggttgtttttggggaggtttgcgcat
gaggaggggcagttttggaagacgatttgtgaggttgctgaggtcgagtgggaagggagg
tga

DBGET integrated database retrieval system