KEGG   Neurospora crassa: NCU10582Help
Entry
NCU10582          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU10582
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     NCU10582
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NCU10582
Translation factors [BR:ncr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NCU10582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 355 aa AA seqDB search
MDTNLWSRRTNSSKLSLTTPGSGGQVDNSSSRTFSKRFGGDSSSHGKTNPFNSITTPGGL
VSPTAGASSAFGLGSGAFASFGSAKTPKTTGNPFETTLIGHSAKTPSAEKSSKEGGLGGK
TVGKTASNASLADANKRAQGAVSNSPSSGLNHQLRNSWVFWYRPPISKANGFIEYEKTLH
PIATCETAEQFFAVYQHLKRPSGLPLVSDYHLFKKGIRPIWEDEENKNGGKWIVRLRKGV
ADRYWEDILLALIGDQFGDASDDVCGIVLSVRNGEDILSIWARANGQRVLKIRETMRRTL
SFPSETKVEWKSHDSSIQQRTAIEESRREKANNRDHSQGDKRTTNRQQQQTDSRP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggataccaacctatggagtcgccgtaccaactcgagcaagctctcattgacaacacct
ggatccggcggccaggtcgataattcgtcttcacgcacattttccaagcgattcggcggt
gatagctcgtcgcacggaaagaccaaccctttcaactctataactaccccaggtgggctg
gtgtcacccacggccggcgcttcgagcgcttttggccttgggtctggcgccttcgcctcg
ttcggttcggccaagactcccaagactaccggcaacccgttcgagaccaccctcatcggt
cattccgcgaagacaccctccgctgagaaatctagcaaggagggcggcctgggcggcaag
accgttgggaagactgcctccaacgcctctcttgccgatgccaacaagagggctcagggc
gcagtgtccaactccccgagttcgggcctaaatcaccagctgcgcaacagctgggtcttc
tggtatcggccccccatctcgaaggctaacggcttcatcgagtacgagaagactctgcac
cctatcgccacctgcgagacggctgagcagttcttcgctgtctaccagcacctcaagcgc
ccctcgggtctgccgctggtgtccgactatcatctgtttaagaaaggaattcggccaata
tgggaggacgaagagaacaagaacggaggaaagtggattgtgcgcctgcggaagggtgtt
gccgatcgctactgggaggacattttgctggctctgatcggtgatcagtttggcgatgcc
agcgacgatgtttgcggcattgttctcagtgttcggaatggcgaggatattctcagcatc
tgggctcgggctaatggccagcgggtcctgaagattcgtgaaacgatgcgccggaccctc
tcattcccctccgagaccaaggtggaatggaagagtcacgactcgagcattcagcagcgc
actgccattgaggagtcgcgtcgcgagaaggcgaacaaccgcgaccatagccagggcgat
aagcggactaccaacagacagcagcagcagacggatagccgcccgtag

DBGET integrated database retrieval system