KEGG   Neurospora crassa: NCU10847Help
Entry
NCU10847          CDS       T01034                                 

Gene name
ngf-1
Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCU10847 (ngf-1)
Transcription machinery [BR:ncr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NCU10847 (ngf-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 410 aa AA seqDB search
MPANSVTALPYNIKMKEENTKRKATEEPTSPSSAKRIKHSDSNEENEDTKKPKIPAIPFP
EKAAVIEERDGEIEFRVVNNDGERESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLS
IAIVKKPLEVVGGITYRPFKGRQFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVM
HFLTYADNYAIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTIMQCSMLPRVRYLEMGRML
LKQKECVQAKIRAYSKSHIVHQPPKQWKNGVTPIDPLSVEAIRASGWSPDMDELARQPRH
GPNYNQLLHLLNDLQNHASSWPFLVPVNKDEVHDYYDVIKEPMDLSTMEDKLEKDQYNTP
EDFIKDAKLIFDNCRKYNNENTPYAKCANKLEKYMWQQIKAIPEWSHLEP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctaattccgtcacggccctgccgtacaacatcaaaatgaaggaagaaaatacc
aagcgcaaggctaccgaggagcctacctctccttcgtcggcgaaacgaatcaagcatagc
gactcgaacgaggagaatgaggacaccaagaagccaaaaatccccgccattcccttccca
gaaaaggccgccgttatcgaagaacgcgacggcgaaatcgaattccgtgtggtcaacaat
gatggcgaacgcgaaagcctgatcattctcaccggtctcaagtgcatcttccagaaacaa
ctacccaagatgcccaaagactacatcgcccgccttgtctacgaccggacccatttgtcg
atcgccatcgtcaaaaagccgctcgaggtagtgggtggcatcacataccgaccattcaag
ggccgccagttcgccgaaatcgtcttttgcgccatttcttccgaccagcaggtcaagggc
tacggtgctcatctcatgtcacatttgaaggactatgtcaaggctacctcggacgtcatg
cacttcctcacatacgccgacaattatgccattggctacttcaaaaaacaaggcttcaca
aaggaaatcacactcgacaagtcagtatggatgggctacatcaaggattatgaaggcggc
actatcatgcagtgcagcatgcttccacgagtacgctacctcgagatgggccgcatgctt
ctcaagcaaaaggaatgtgttcaggccaagatccgtgcctacagcaaatctcacattgtc
caccagccccccaagcagtggaagaacggcgtaacacccatcgaccctctttcagtcgag
gccatccgcgcttcaggatggagcccagatatggacgagctcgcccgtcagccacgccac
gggccaaattacaaccagctgctgcacctcctcaatgatttacagaatcatgccagtagt
tggcccttcttggtacccgtcaacaaggacgaggtacatgactactacgatgtcatcaaa
gagcctatggacttgagtaccatggaggacaagcttgagaaagatcaatacaacacgccc
gaggatttcatcaaggacgccaagctcatattcgacaactgccgaaagtacaacaacgaa
aacaccccatatgcaaagtgcgccaacaagctcgagaagtacatgtggcagcaaattaag
gcgattcccgagtggtcacacctcgagccttag

DBGET integrated database retrieval system