KEGG   Neurospora crassa: NCU10852Help
Entry
NCU10852          CDS       T01034                                 

Definition
similar to exochitinase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ncr  Neurospora crassa
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCU10852
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NCU10852
   00603 Glycosphingolipid biosynthesis - globo series
    NCU10852
   00604 Glycosphingolipid biosynthesis - ganglio series
    NCU10852
   00511 Other glycan degradation
    NCU10852
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NCU10852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 628 aa AA seqDB search
MVFVPSLRLLAVSLVALLEPVSAIWPAPQSFTKGNSSLYLHPKINVTYNGEPVRRPTSSS
SSSSFFLSSSNNVGGSAGPGYEGLFTKTPAQQQLVYKEDYFASSLSSKEIVHAGVSRALG
SIFSRNIVPWMLQPRGKLSEFEPDLYKGQNWIKSLEIDQTAKDAKTAFKPALAGEVSEAY
SLTLSVEGDVKLTADSYIGVLHGLETFTQLFYQHSTGTSWYTPYAPVEIKDEPKYPHRGI
LLDVARTFMPVKNILRTIDGMATSKLNRLHVHVTDSQSWPLQIISMPEVAEKGAYHSSQT
YSPADIDLIQKYGALRGVQVYFEIDMPGHIGSLSLSHPDLIVAYDQWPYQWYCVEPPCGA
FKLNDTKVDDFLGKLWDDLLPRVAPYSAYFHTGGDELNRNDSMLDDGIKSNDTEVLRPLL
QRFVDKQHERIRKEGLTPLTWEEIPIEWNVNLGKDVVVQTWLGQSSVKNLTSRGHKVIDS
NYNFWYLDCGRGQWLNFDNADYAAFSPFLDWCSPYKSWRHVYSYDPAANLTEEEAKLILG
GEVAVWAESIDPIALDTIIWPRASAAGEVLWSGRIDPATGQNRTQLDAAPRLSELRERLV
ARGVQSSSVYMTWCTQDPTGKSCEYPRV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggtctttgtgccctcgctgaggctgcttgcagtctcactcgttgccctcctcgagcca
gtatccgcgatatggccggcaccgcagagcttcaccaagggcaactcaagtctgtacttg
catccgaagatcaacgttacctataatggagaacctgtaaggcgcccgacttcctcctcc
tcttcctcctctttctttctctcttcatccaacaacgtgggcggatctgctggtccgggc
tatgagggcctgttcactaaaacaccagcgcaacaacagctcgtctacaaagaagactat
ttcgcctcaagcctgagcagcaaagagatcgtccatgccggcgtctcgcgcgcactgggc
tccatcttctccaggaacatcgtcccctggatgctccagccccgcggaaagctgtctgaa
ttcgagcccgacctctacaagggtcagaactggatcaagtcgctcgagatcgatcagacg
gccaaagatgccaaaaccgccttcaaacccgcactggccggcgaggtcagcgaagcgtac
agcctcacccttagcgtcgagggcgacgtcaagctgacggctgactcttatatcggcgtg
ctgcacggcctcgagacgttcacgcagctcttctaccagcactcgaccggcacatcgtgg
tacacgccgtacgcgcccgttgagatcaaggacgagcccaagtacccgcaccgcggcatc
ctgctcgacgttgcgcgcacattcatgcccgtaaagaacatcctccggaccattgatggt
atggccaccagcaagctcaaccggctgcacgtgcacgtcaccgattcgcaatcatggccg
cttcagatcatctccatgcctgaggtggccgagaagggcgcctaccattcgagccagacg
tactcgcccgccgacatcgacctcattcagaagtacggtgccctccggggcgtgcaggtg
tactttgagatcgacatgccgggccacatcgggtccttgtcgctctcgcacccggacctt
attgtcgcatatgaccagtggccgtatcagtggtactgcgtcgagcctccttgcggcgcc
ttcaagctcaacgacaccaaggtcgacgactttctcggaaagctgtgggacgatctgctg
ccccgcgttgcgccgtactcggcctacttccacactggcggggacgagctgaacaggaac
gactcaatgttggacgatggcatcaagtcgaatgatactgaggtgctgcgcccgctgctc
cagaggttcgtcgataagcagcacgagcgcatcaggaaggagggcctgacgcccctcact
tgggaggagattccgatcgagtggaatgtcaatcttggcaaggatgtcgtggtgcagacg
tggcttggtcagtcttcggtcaagaacttgaccagcagaggccacaaggtgattgatagc
aattacaacttttggtacctcgactgcggccgcggccaatggctcaactttgacaacgcc
gactacgccgccttttcgcccttcctcgactggtgcagcccctacaagagctggcgccac
gtctattcgtacgacccagccgccaacctgaccgaggaagaggccaagctcatcctcggc
ggcgaggtggccgtatgggccgagtccattgaccccattgccctcgacaccatcatctgg
ccgcgggccagtgctgctggcgaggttctctggtccggacgcatcgacccggccactggc
cagaaccggacgcagctcgatgcggcgccgaggctgtcggagctcagggagcgcttggtc
gccaggggcgtgcagtcgtcgtccgtgtacatgacgtggtgtacgcaggatccgacgggc
aagtcgtgcgagtatccgcgggtttga

DBGET integrated database retrieval system