KEGG   Neurospora crassa: NCU11238Help
Entry
NCU11238          CDS       T01034                                 

Definition
mitochondrial 2-methylisocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ncr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ncr00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 618 aa AA seqDB search
MLRRAIPRISRRTVPAQTSSPLFGLCARPVRTSTTTSAHARLLSTSAARMTAPSPLAPVE
HPFSSTIPFESFQLLPEEQKAGAAEDALLQQQIKEVEAWWASPRFKGIKRDWTAADVVSK
RGSLQQTYTSSVMARKLWNLVQERYAQGKPIHTLGAIDPVQMTQQAPHQEVLYISGWACS
SVLTSTNEVSPDFGDYPYNTVPNQVQRLHKAQSMHDRKQWFLRSKMTPEERAKTPYTDYF
RPIIADGDTGHGGLTAVMKLAKLFAENGAAGVHFEDQMHGGKKCGHLAGKVLVPTGEHIN
RLKAARFQWDVMGTENLVIARTDSESGKLLSSSIDARDHEFILGVADPSITSLAETLADM
EARGAPGSEIDAYEAEWVKNTKLVTFDEAALAHFEHHNVRQDLFATYKATIAQNPNMGIT
ARRALAQSITPEHPVYWDWDVPRTREGFYHFRNGMAAATKRALAFGPYADLLWVETGDPS
VEVATELGRAVREQFPGKGLVYNLSPSFNWMAHGFTQDTLKSFVWDIAKEGFTLQLVSLA
GLHSTATISNELARRYKNEGMQAYVELVQKREKELGVDVLTHQKWSGANYVDAILGHIQS
GSSSSKSMGEGNTENQFV
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcagggcaatccccagaatctcccggcgaactgtcccggcgcagacttcatcc
cccctcttcggtctttgcgcccgccccgtgagaaccagcactaccacctccgcgcacgct
cggctcctctcgacatcagctgctaggatgaccgctccctcgcctctggctcctgttgag
catcctttctcctcgaccattccttttgagtccttccagcttttgcccgaggagcagaaa
gccggcgcggccgaagatgccctcctccaacaacagatcaaggaagtcgaggcttggtgg
gcgtcgccgcgcttcaagggcatcaagcgcgactggactgctgccgatgtcgtgagcaag
cgcggttcgctccagcagacctacacttcgtccgtcatggcgcgcaagctctggaacttg
gtgcaagagcgctacgcccagggcaagcccatccatactctgggtgccatcgatcccgtt
cagatgacccagcaggcgcctcatcaggaggtcctctacatttctggttgggcatgctcc
tcggttctgacttccaccaacgaggtatcgcccgactttggcgactacccctacaacact
gttcccaaccaggtccagcgtctccacaaggcccagagcatgcatgaccgcaagcaatgg
ttcctgcgcagcaagatgactcctgaggagcgggccaagaccccttataccgactacttc
cgccccatcattgccgacggcgacaccggccacggcggcttgactgccgtcatgaagctt
gccaagctgttcgccgagaatggtgccgccggcgttcactttgaggatcagatgcacggt
ggcaagaagtgcggtcaccttgccggcaaggttctcgtccccaccggcgagcacatcaac
cgcctcaaggccgcccgcttccagtgggacgtcatgggcaccgagaaccttgtgatcgct
cgcacggactccgagagtggtaagctgctttcttcctccatcgacgcccgcgatcacgag
ttcatcctcggtgtcgccgacccctccatcacctccctcgccgagaccctcgccgacatg
gaagcccgtggtgctcccggttccgagatcgacgcctatgaggccgagtgggtcaagaac
acgaagctcgtcaccttcgacgaggctgctcttgcccactttgagcaccacaacgtccgc
caggacctcttcgccacctacaaggccaccattgcccagaaccccaacatgggcatcacg
gcccgccgtgccctggcccaatccatcacccccgaacacccggtgtactgggactgggac
gtgccgcgcacgcgcgagggcttctaccacttccgtaacggcatggcggccgccaccaag
cgcgccctcgccttcggtccctacgccgacctcctctgggtcgagacgggcgacccgtcc
gtcgaggtggccacggagctcggccgcgccgtgcgcgaacagttccccggcaagggtctc
gtatacaacctttccccttcgttcaactggatggcccatggcttcacccaggacacgctc
aagtcgttcgtctgggacattgcgaaggaaggtttcacccttcagctcgtctcgctcgcg
ggtctgcacagcaccgccaccatcagcaacgagctggcccgccgctacaagaacgagggc
atgcaggcgtatgttgagctggtgcagaagcgcgagaaggagctcggtgttgatgtgctc
acgcaccagaagtggagcggcgccaactatgttgatgccattctgggacacattcagagc
ggtagctcgagtagcaagagcatgggcgagggtaacactgagaaccagttcgtataa

DBGET integrated database retrieval system