KEGG   Neurospora crassa: NCU11320Help
Entry
NCU11320          CDS       T01034                                 

Definition
similar to agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ncr  Neurospora crassa
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCU11320
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NCU11320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 336 aa AA seqDB search
MAMAVTWSFSGITTFAHLKHVKCLTTPSEKFDIAIVGAPFDTATSYRPDCGDIPITPFDN
AVALEQMSEAFVELGSRSAALGETEKGKGKGKRKPKLITLGGDHSLALPALRALRKVYGR
EVRVVHFDAHLDTWHPAKYPSAWPSTQSHFNHGSMFWLAGQEGLLSNSSPASNIHAGLRT
RLSGTDPSDFVDDASQNWLRISADDIDDLGGPAGVIAAIMDQFDLNDPDPDPVYLSIDID
VLDPAFAPGTGTPEPGGWTTRELIRILRGLVDVLNVVGADVVEVSPAYQGRGEETALAAA
QVVYEVLTGMVKRGLKNGFSEEKVKGGGVDKAHDEL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcggtgacgtggtcattctccggcataaccacctttgcccatctcaaacac
gtcaagtgcctgactacgcccagcgagaagtttgatattgccattgttggcgcgccgttt
gacacggctacttcttatcggcctgactgtggtgacatccctatcacgccatttgacaat
gctgtggcgctggagcagatgtcggaggcttttgttgagctggggtcgagaagtgctgcc
ctgggtgagacggagaaggggaaggggaaggggaagaggaagccaaagttgattactctc
ggtggtgatcacagcttggcgctgccggcgttgagagcgttgaggaaggtatatgggagg
gaggtgagggttgtgcattttgatgcccacctcgacacctggcacccagccaagtacccc
tccgcctggccctcgacccaatcgcacttcaaccacggctccatgttctggctcgccggg
caagaaggtcttttgtccaacagttctcccgcctccaacatccacgccggcctccgcacc
cgcctctccggcactgacccctctgattttgtcgatgacgcctcgcaaaactggctgcgc
atatcagcggacgatatcgacgacctcggcggtcccgcaggcgtcatagctgccatcatg
gaccaatttgacttgaacgaccccgatccagacccggtgtacctgtccatcgacattgac
gtgcttgatccggctttcgctccaggcacgggcacgccggagccgggagggtggacgacc
agggagttgataaggattttaagagggctggtggatgtgctgaatgtggtgggtgcggat
gtggtggaggttagtccggcgtatcaagggagaggggaggaaacggcattggcggctgcg
caggttgtctatgaagtgctgacggggatggttaagagggggttgaagaacggttttagt
gaggaaaaggtgaagggtggtggtgttgacaaggctcatgatgaactttga

DBGET integrated database retrieval system