KEGG   Neurospora crassa: NCU11376Help
Entry
NCU11376          CDS       T01034                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCU11376
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCU11376
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   NCU11376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 454 aa AA seqDB search
MADLVGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVWYVHLLLLPFLLSRLCFWAAAHL
HVSCHILMIQADLPFLLNSAAVNTQTNEGVAIKKVTNVFSKKILAKRALREIKLLQHFRG
HRNITCLYDMDIPRPEMFNETYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKY
IHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEYVATRWYRAPEI
MLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTPNEETLSRIGSP
RAQEYVRNLPPMPKKSFQQLFPQANPDALDLLDRMLAFDPTSRISVEDALKHPYLAIWHD
ASDEPDCPTPFNFDFEVVDDVGEMRKMILDEVFRFRQLVRTVPGGQGQGGAQPQAPAQVP
MPTDVHSQQWTAEDPRPHEYGAYNGGLEAELGGM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcgtgggtcgcaagatcttcaaggtcttcaatcaggactttattgtcgac
gagcgctacaccgtcaccaaggagctcggtcagggagcttatggcattgtctggtacgtc
cacctgctcctgctcccgttcctgcttagccgcttgtgcttttgggccgcggcgcatcta
catgtgtcatgccatattctcatgattcaagctgacctccctttcctcctaaacagcgcc
gccgtaaacacccagacgaacgagggagtcgccatcaaaaaggtcaccaatgtcttcagc
aaaaagatcctagccaagcgcgccttgcgcgagatcaagctcctccaacacttcaggggc
caccgtaacattacctgcctctacgatatggacattccccggccagagatgttcaacgag
acctatctctacgaggagttgatggagtgcgatcttgctgctatcattaggtccggtcag
ccacttacagacgcccacttccagtccttcatctaccagattctttgcggtctcaagtac
atccactcggcaaacgttctgcaccgtgatctcaagcccggtaacctgctggttaatgcc
gactgcgagctcaagatctgcgactttggtcttgcgcgtggtttctccgtcgaccccgag
gagaacgcaggttacatgacggagtacgttgccacgagatggtatcgtgctcctgaaatc
atgttgtccttccagaactataccaaagccattgatgtatggtccgttggctgtatcctt
gccgagcttctcggtggccgcccattcttcaagggcagagattacgtcgatcagctgaac
cagatcctgcacatcctcggcacaccgaatgaggagaccctctcccgtatcggctctcct
agagctcaggaatacgtccgcaacctgcctcccatgcccaagaagtccttccagcagctc
ttcccccaggccaaccccgacgccctcgatctcctcgaccgcatgctcgccttcgaccct
accagccgtatcagcgttgaggatgctctcaagcacccctaccttgccatctggcacgat
gccagcgacgagcccgactgccctacccccttcaacttcgactttgaggttgtcgatgat
gtcggcgagatgcgcaagatgattctcgatgaagtcttcaggttcagacagcttgtgcgc
accgtgcccggtggtcaaggacagggcggtgctcaaccccaggctcccgctcaggtgccc
atgcctactgatgtgcacagccaacaatggactgctgaagatcctaggccacatgagtat
ggcgcgtacaacggtggcctggaggccgagcttggtggcatgtaa

DBGET integrated database retrieval system