KEGG   Naumovozyma castellii: NCAS_0A00710Help
Entry
NCAS_0A00710      CDS       T02233                                 

Gene name
NCAS0A00710
Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
ncs  Naumovozyma castellii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:138727..141186
Genome map
AA seq 819 aa AA seqDB search
MLRTISNTVNNDSIIVKNLKLQSIVGLDAWNARNPQTCLISMTLNTNFKESSATDDLKFS
LNYAVLCNDITNLAQSKKEWKSVYAFSNAISSYTMNKYEQVDKLNLDVQLTNAHLRTQNV
SFQVGIDRNDKIPASKYMLIKNLDLFTLIGVFNFERLQKQKLSLDIKLPVTDEHSDIPFK
TIIDKVVTYTEGANFKTVEALGECIIKLVSQDPFYQDTAFLHSLIEVTVIKHNAITETDG
VGISCARSPEEVVSNPTIKLNGTKESSESNGYNMPVDQSTAIATTSTDINTKYNTAYLAF
GSNVGDRVSNIKLAFDALKRENEKIVILDQSSFFESEPMYFKDQEPFINGCIKIKTILSP
HELLRVCKHIEYEVLGRVKHFDNGPRSIDLDIVLYQNADNEPILINDEDLIIPHPRMLER
SFVLEPLCQLLPPTTRHPITAEPIWNHLDELYAKGNDEDNLWLVTPLPGKTLNTKKEKFL
KFKTVTVKDPITNLSKRESVSPTYIMHILNVTPDSFSDGGKYYSPENISTTLHHLVQVTQ
EVLKLHDCIIIDVGGCSTRPNSEQVSEKNELGRVIPIISAIRTCKELPKDKVIISVDTYR
STVSQQAFEAGADIVNDISGGAFDSNMFSQSARIGGGYVLSHTRGTISTMNKLTDYTWKN
TDVMEGKYVHYISGKEIDPKNEQLTLITTIGQELSVRFLAALDSGLHRGQMILDPGLGFA
KNLDQNLEIIRTIPLLKNYSCVTPDGRFVTFKNLPILLGPSRKKFIGTITMEPEPHNRDF
ATGSVVASCIGYGTDIVRVHDSINCSKSVKIADKIYKKV
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacgatatcgaacacagtgaataatgacagcatcatcgtgaaaaatttgaaa
ttacaaagcattgtagggttagatgcatggaatgcaagaaatcctcagacatgtctgata
tccatgacattaaacacaaatttcaaagaaagttctgccactgatgatttgaaattctca
ttgaactacgctgtgttgtgtaatgacataacaaatttggcccaatctaagaaggaatgg
aaaagtgtatatgcgtttagtaatgcaattagttcttatactatgaacaagtacgaacag
gtagacaagttgaaccttgacgtgcagctgacaaacgctcatctgcgaactcaaaacgta
tcattccaagttggtattgatagaaacgataagattcctgcatctaaatatatgcttata
aaaaatttagatttatttacattgattggtgtcttcaattttgaaagactacagaaacaa
aaactttcacttgatattaaattacctgtcactgacgaacactctgatatcccattcaaa
actattattgataaggttgtgacatacacggagggtgcaaattttaagacagtggaagca
ttgggggaatgtattattaagcttgtttcccaagatcctttttatcaggatacggctttc
ttgcattctcttatagaagtcacggttattaaacataatgccatcactgaaactgatggt
gtcggtatatcatgtgcaagatctccagaagaggtagtttctaatccaaccatcaaattg
aatggaactaaagaaagtagtgaatcaaatgggtataacatgcccgtggaccaatctact
gccattgcaacaaccagcacagatataaacaccaaatataatactgcatatctagcattt
ggatccaatgtgggtgacagggtctccaatattaaattggctttcgatgcattgaaacga
gagaacgaaaagattgtaattttggatcaatcttcatttttcgagagtgaacccatgtat
tttaaggaccaagaacccttcattaacggttgtatcaaaattaagacaatactttcgcct
catgaattgctacgtgtttgcaaacatatcgaatatgaagtcttggggagagtgaagcat
ttcgataatggtcctagatcaattgatttggatattgtcctgtatcaaaacgcagacaat
gagcctatattgattaatgacgaagatttgatcatcccacaccctcgtatgttagagaga
agttttgtcctagaaccactctgtcaactacttcctccaacgactcgacatcctattaca
gcagaaccaatctggaatcatctagatgaactatatgcgaagggcaacgatgaggacaat
ttatggctagtaacaccactacctgggaagactctcaatacgaagaaggaaaaatttctt
aaattcaagactgttacagtaaaggaccctattactaacttatccaaacgagaatctgtt
tcacctacatatatcatgcacattttaaatgtaacaccagattcgttctctgatggaggg
aaatattattcacctgaaaatatctcgaccacattacatcacctcgtacaggttacccag
gaggttttgaagttacatgattgtattattattgacgttggtggttgttctactcgcccc
aactctgaacaggtatctgaaaagaatgagttgggtagagttatcccaattatttccgct
ataagaacatgcaaagaattacccaaggataaagtgattatttcagtcgatacgtatcgt
agcacggttagccaacaagcttttgaagcgggtgctgatattgtcaacgacatttcaggt
ggtgcttttgattctaacatgttctcgcaatctgcccgtattggaggtggttatgtcttg
tcacataccagggggactatctccactatgaacaaactgacagattatacttggaaaaat
acagacgttatggaaggaaaatatgttcattacattagtggtaaggagatagaccctaag
aatgaacaattgactttaattaccactattggccaagaattaagtgtacgtttccttgcc
gcattggatagtggcctacatcgtggacaaatgatattggatccaggtcttggatttgct
aagaatttggaccaaaatttggaaattattcgtactatcccattattaaaaaattattca
tgtgtgacaccggatggtcgttttgtcacttttaagaatctaccaatcttgttaggtcct
tcaagaaagaaattcataggaaccattactatggaaccagagccacataatagagatttc
gccactggttccgtagttgcttcttgcattggttatggcacagatatagttagggtacat
gactcaatcaattgctccaagagtgtgaaaatagccgataagatatataagaaagtgtaa

DBGET integrated database retrieval system