KEGG   Naumovozyma castellii: NCAS_0A01100Help
Entry
NCAS_0A01100      CDS       T02233                                 

Gene name
NCAS0A01100
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ncs  Naumovozyma castellii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NCAS_0A01100 (NCAS0A01100)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NCAS_0A01100 (NCAS0A01100)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   NCAS_0A01100 (NCAS0A01100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:218400..219464
Genome map
AA seq 354 aa AA seqDB search
MNVDTGIGGTPMVAEGQQQQQQVPRSQLPQRSVVSKGKYTLHDFQVMRTLGTGSFGRVHL
VRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMV
MDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGH
IKITDFGFAKEVDTVTWTLCGPPDYIAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFY
DTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWFSE
VVWEKLLAKDIETPYEPPITTGIGDTSLFDQYPEEQFDYGIHCEDPYQEYFTEF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggacactggaattggtggtacaccaatggttgctgaaggacaacaacagcaa
cagcaagtaccaagatcccaattaccacaaagatcagtggtttcaaaagggaagtacact
ttgcatgattttcaagttatgagaacattgggtactgggtcctttggtagagttcatctt
gtgaggtcggttcataatgggagatattatgctataaaagtattgaagaaacaacaggtg
gtccgtatgaaacaaattgaacatactaatgatgaacgacggatgctaaagttagtggaa
caccccttcttaattagaatgtgggggacgttccaggattcaagaaatttatttatggtt
atggattatattgaaggtggtgaattattctcattattaaggaagtcacaaagattccct
aatccagtagctaaattctatgctgctgaagtgactcttgggttggaatatttacattct
cataatattatttatagagatttaaaacccgaaaatattctattggatagaaatggacat
ataaagataacggattttgggtttgcaaaagaagtggatactgtgacatggacattatgt
ggtccacctgattatattgcaccggaagtgattgccactaagccatataacaaatcagtt
gattggtggtctcttggggttttgatatttgaaatgttggcaggttatactccgttttat
gataccacaccaatgaaaacatatgaaaaaattttacaaggtaaagttgtttatccgact
ttctttcatcccgatgtagtagatttactagggaaattaattactgcagatttaactaga
agaattggtaatttacaaagtggttcgaaggatatcaaatgtcatccatggtttagcgaa
gttgtttgggagaaattgttagctaaggatattgaaacaccttatgagcctcctattact
actggtattggtgatacttctttatttgatcaatatccggaagaacaatttgattatggt
attcactgtgaagatccataccaagagtattttacagaattctga

DBGET integrated database retrieval system