KEGG   Naumovozyma castellii: NCAS_0A01100Help
Entry
NCAS_0A01100      CDS       T02233                                 

Gene name
NCAS0A01100
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ncs  Naumovozyma castellii
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ncs04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:218400..219464
Genome map
AA seq 354 aa AA seqDB search
MNVDTGIGGTPMVAEGQQQQQQVPRSQLPQRSVVSKGKYTLHDFQVMRTLGTGSFGRVHL
VRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMV
MDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGH
IKITDFGFAKEVDTVTWTLCGPPDYIAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFY
DTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWFSE
VVWEKLLAKDIETPYEPPITTGIGDTSLFDQYPEEQFDYGIHCEDPYQEYFTEF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggacactggaattggtggtacaccaatggttgctgaaggacaacaacagcaa
cagcaagtaccaagatcccaattaccacaaagatcagtggtttcaaaagggaagtacact
ttgcatgattttcaagttatgagaacattgggtactgggtcctttggtagagttcatctt
gtgaggtcggttcataatgggagatattatgctataaaagtattgaagaaacaacaggtg
gtccgtatgaaacaaattgaacatactaatgatgaacgacggatgctaaagttagtggaa
caccccttcttaattagaatgtgggggacgttccaggattcaagaaatttatttatggtt
atggattatattgaaggtggtgaattattctcattattaaggaagtcacaaagattccct
aatccagtagctaaattctatgctgctgaagtgactcttgggttggaatatttacattct
cataatattatttatagagatttaaaacccgaaaatattctattggatagaaatggacat
ataaagataacggattttgggtttgcaaaagaagtggatactgtgacatggacattatgt
ggtccacctgattatattgcaccggaagtgattgccactaagccatataacaaatcagtt
gattggtggtctcttggggttttgatatttgaaatgttggcaggttatactccgttttat
gataccacaccaatgaaaacatatgaaaaaattttacaaggtaaagttgtttatccgact
ttctttcatcccgatgtagtagatttactagggaaattaattactgcagatttaactaga
agaattggtaatttacaaagtggttcgaaggatatcaaatgtcatccatggtttagcgaa
gttgtttgggagaaattgttagctaaggatattgaaacaccttatgagcctcctattact
actggtattggtgatacttctttatttgatcaatatccggaagaacaatttgattatggt
attcactgtgaagatccataccaagagtattttacagaattctga

DBGET integrated database retrieval system