KEGG   Naumovozyma castellii: NCAS_0A01270Help
Entry
NCAS_0A01270      CDS       T02233                                 

Gene name
NCAS0A01270
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NCAS_0A01270 (NCAS0A01270)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:245601..247667
Genome map
AA seq 688 aa AA seqDB search
MDNTDIIVLTLLFLGLALYYNRETIRYIFSSDDDDVTAVNSSGSRDIVQVLLENNKNYLV
LYASQTGTAEDYAKSFSKELSSKFSSLNVMCADIESYDFDTLNSLPKDIIVSFFISTYGE
GDFPDGSFSFEQFIITASDDALSLNNVDFTIFGLGNSTYEFYNGAAKKCRKYLVGAGATQ
LGPLGEGDDGRGTTDEDYLAWKEEMLEILKSKLQLSERDQIFSPSYDYIELSEINDSVAL
GEPSKEYLPNEKLNVNAQGVQVGPFDHSHPYVAPVTSSRELISNSEDRHCVHIEFDLRGS
NLKYSTGDHVAIWPSNPVEKVNQFIKVFNLNPDEIFELKCLDETIKPPFPTPTTIHAAVT
HYMQITGPVSRQFITQLVQFAPNDEIKERLVTLSKNKEKFADEITSKNLNIADIIDIINK
DSEKPFIAPWNFLIESIVRLQPRYYSISSSSLSERQTVHVTAVVESSFNEVTNNATVGIT
TNLLRNIELVQNDENDSNLPVHYELDGPRHLFESFKLPIHIRRSTFKLPSNPQTPIIMVG
PGTGVAPFRAFIRERVKFLETNNDNLTLGKHLLFYGSRNHDDFLYKEEWPIYAEKLGDSF
EMIVAHSRLDPGKKVYVQHNLKERSEEVFQLISQGAFIYVCGDAQGMAKDVNETLIKILA
EGKNIKESEASDIIKALKVSGKFQEDVW
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggataacacggatattattgttcttactttgctcttcctgggtctggcattgtactac
aacagagagaccattaggtacatattctcctccgatgacgacgatgttaccgctgtcaac
tcgtctgggtccagagacattgtccaagtattgctagaaaacaacaaaaattacttagtt
ctttatgcttcccaaacagggactgcggaggattatgccaaatcattctccaaggaattg
agtagtaagttctcgtcattaaatgtcatgtgtgctgatattgaatcatacgattttgat
actttgaattcgctacctaaagatattattgtctctttctttatctccacgtatggtgaa
ggtgattttcccgatggatccttctcatttgagcaatttataatcactgcaagtgatgat
gcattgtctttgaataatgtggatttcacaatttttggattggggaattctacttatgaa
ttttataatggtgctgctaagaaatgtagaaaatatttggttggtgctggtgctacacaa
ttgggccctctaggggaaggtgatgacggaagaggaaccactgatgaagattatttggcg
tggaaggaggaaatgttggaaattttaaaaagcaaattgcaattgagtgaaagagaccaa
atattttctccttcatacgattatattgaactatctgaaattaatgattctgttgctttg
ggagaaccttccaaagaatatttgcctaatgaaaaattgaatgtaaatgcccaaggtgtt
caagtcggacctttcgatcattcccatccatatgtagcgcctgtcacttcttccagagaa
ttaatcagtaatagtgaggatagacattgcgttcatatcgaatttgatttaagaggatcc
aatttgaaatactcaactggtgatcatgttgccatttggccatctaatcccgttgaaaaa
gtcaatcaatttattaaagtgtttaacttgaaccctgatgaaatctttgaattgaaatgt
ttagatgaaactataaaacctccttttcctacccctaccactattcatgccgcagtaacc
cattatatgcaaattaccggacctgtttcaagacaattcattactcaactggttcagttt
gcaccaaatgatgaaatcaaagaaagattggttactctatctaagaacaaggaaaaattt
gctgatgaaattacatctaaaaatttaaacattgctgacatcattgatatcattaacaag
gattccgaaaaaccattcattgcgccctggaatttcttaatcgaatctattgttcgatta
cagccacgttattactccatttcttcctcatctttatctgaaagacaaactgttcatgtc
actgcggttgttgaatcgtcatttaatgaagttaccaataacgccactgtaggtattacc
actaacttgttaagaaatattgaacttgttcaaaacgatgaaaatgattccaatctccct
gtacattatgagttagatggtccacgtcacctattcgagtcatttaagttacctatccat
attcgccgttccactttcaaactacccagcaatccgcagactccgataattatggtggga
cctggtacaggtgtggcaccatttagagcgttcattagagaacgtgtcaagtttttggaa
actaataatgataatttaactttggggaagcatttattattttatggttcgagaaatcat
gacgattttctttataaagaagaatggcccatttatgctgaaaaactgggtgattcattt
gaaatgatagtggcccattcgaggttggaccccggtaagaaagtttacgtacaacataat
ctaaaggaaagatccgaggaagttttccagttgatttcacaaggtgcattcatctacgtt
tgtggtgatgctcaaggaatggctaaggatgttaatgaaactttgatcaagatattagca
gagggaaaaaacattaaggaatctgaagcatcagacattattaaggctttgaaggtatca
ggaaaattccaagaggatgtatggtga

DBGET integrated database retrieval system