KEGG   Naumovozyma castellii: NCAS_0A01330Help
Entry
NCAS_0A01330      CDS       T02233                                 

Gene name
NCAS0A01330
Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ncs  Naumovozyma castellii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ncs03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(259414..264504)
Genome map
AA seq 1696 aa AA seqDB search
MKWSSAPFEALYYSIEIDQFDVNLFHDLLPDLQQLNLNQGKQKNNASRTQLEKGELTLSD
GSSYKFNQQFIIAAINLSDELNLDELVVAELIISGSESGAPLENMDNLSLINVGKRQYFF
RRQYILQILAYLIDCLQNDNQIYKDLTQDAKLLNNILPAFESIHLQLSEVKDSINKAQIL
ENFNSLIQQNIKFKMDSLLKEYDILSQILFGLINKESEIKQKTILDVVNHVTQMDSDDFF
IVYYLPAIFHAFNNLDKFPDNDVKELHAQFLKDLEREDIYTKPIKVAIIFIFLTSFISWC
KVNPKTRAKLIDFKTAVDEPMTAAVELGAIEQLLIIAADTSIVEQDKSMELFYDIRSLLE
RHIPRLRPKQLQMDRTGDNNNTTEVSSAITATTNTMTNDGSRSSLMDLNQQFQNIILSDQ
TESFFLSSFNCSLQRVIADCAFLLTKVKDAEEDSLLSGEDLSLDDVCVKADLERFFLTVY
YFYASRPNLSCEFWNDKESNSYGFIEWSSKCTDSLMKSCFYLMISSLSFGHDNAINVFHY
FGDNNAISWTTISQSISDYIVKINNLSKTVQQRQQQIEDTTTNNNNNELDSITVALDEGL
NEEAIIFLSSLLTLIGSVAHDVDEDTKVILSNTFSNILFEFAKVDTPLIGACFKTLGQLV
PEETSSKLNLWRSLDTLIFKTATLTNATDSYKSAFKSILINYNEILGFLQLFNNLLKIES
TYLNTNGFLTFGKLSFPARLGQGYRKLGIWPYFDYILNDIFVSSHLIPDSDNRRAIQLPI
LEIIETSLYSFDYSIILNSLLIGTNLDQFGANLDFFTYVQESPATVIFNHLFTEKIYKSL
FKIINVGVDHLSIDLGGGSTQLRLIKQGIKIINLVLEFQATFAEEFVNIITKQKNKEYYL
PKNFGLHGLPSFYDAIFFNLPIVAHLGLYVGLDNYDVALESLNALIKLENNSPSNESGSA
GPNKLLTIFDAVDDSARIKEAFISQIEASIDCDEQLTLKYQILNFIDSMLSLKDQKPTLA
HFLLGFQVTNVISTGPALSTFINSDISLFKSVASLLESSLSAINSDRIAYAPIRLASLSL
EIILKLCSNPLTSNVILDYLIHDHFFERIIQLDPHVTKFTLWEDLSFDSSQIDNGIEFIG
KKPMGALLYFLTYRAHLIQCLSLFIHRLSFTGTKSETLTQIKYLISNQIYSTRIFSFLDT
LNYGALSNNEELSKQINIFKNIPLNLDNITISDCPSDEIIFDYSELMSILNLEAKVYKMS
NKNDENLLQNSDSKLVVDVHIEEEIELVKLCVASYLGHQRFMEEQLRILHSWVQLTQIIV
TDGDLSSVERSNFILEVFGNIIPKINDYVELDVSFSEELTSLAVFLNDMYQKDRMQIDGL
QAVDSRLYNMFKVCLHGIMSPLSSVSLKSDFYVLTNSYLVRTLKEKKLAKELLQDLRMNN
EKLVEVICNDVIYVQGAGKITGILLLDSLIQLGNLNKENFILTTLLKSTHLLSIVHSLKS
TDSMITATKEKIEIDDLLYELTAFKATVFFLIRVAGTKIGAHALVQSKLFEVLGACSFLN
IDPDLGLELVANEFSTGKSDFIRINVNLDSSSSLDKGVNNISLFELIVPVFQLLCSVLIS
MGSTNKSVIQSVRKLLVKFRKLLVGVFRREALTKQQDAATMKYPSSHGLEEMVKLIVILC
TLTGYRGEDTVPNLIE
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggtcatccgctccatttgaagcactatattactcaatcgaaatcgatcaattc
gacgttaatctcttccatgatctattacctgatttacaacaattgaaccttaaccagggg
aaacaaaagaataacgcaagtagaacccaattagaaaagggtgagttaacgttatctgat
ggctcttcctacaaatttaaccaacaattcatcatagctgccattaatctatctgatgaa
ttgaatctggatgaattggtagtagctgaacttatcatctcaggatctgaatcaggtgca
ccattggaaaatatggataatttatcattgattaacgtcgggaaacgtcaatatttcttt
agaagacaatacattttacagatattggcctatttgatcgattgtttgcagaacgataat
caaatatataaagatttaactcaggacgctaaattgcttaataatatcctaccagcattt
gaatccattcatttacaattgtcagaagtgaaagactccattaataaagctcaaatttta
gaaaactttaattctttaattcaacaaaatattaaattcaaaatggattcgttattgaaa
gaatatgatatattaagtcaaatacttttcggtttgataaacaaagaatcagaaataaaa
caaaagacaatattagatgttgtcaaccatgtaactcaaatggattctgatgatttcttt
attgtttattatttacctgccattttccatgcattcaataacttggataaatttcctgat
aatgacgttaaggaactacatgctcagttcttaaaggatttggaaagagaggatatttat
actaaacccattaaagtggctataatatttatattcttgacatcattcattagttggtgt
aaagtgaacccaaaaacaagagccaaattgatcgatttcaagacagctgttgatgaacca
atgactgcagccgtagaactgggtgccattgaacaattactaattattgccgctgataca
tccatcgtggaacaggataaaagtatggaattgttttatgatataagatccctattggaa
agacatatcccacgactaagaccaaaacaattacagatggatcgtactggtgacaataat
aatactaccgaggtatcgtctgcgataacagcaacaacaaatacaatgacaaacgatggg
agccgaagttccctcatggatcttaatcaacaatttcaaaatattattttatctgatcaa
actgaaagtttctttctttcatcattcaattgctctttacaaagagtcattgcagattgt
gccttcttattgacgaaggtgaaggacgcagaggaagattcgttattatcaggtgaagat
ttgagtttagatgacgtttgcgttaaagctgatttagaaagattttttttaacagtttat
tatttctatgcatcaagaccaaatctttcatgtgaattttggaatgataaagaatcaaac
tcatatggattcattgaatggtcttctaaatgtacggatagtttaatgaaatcatgcttc
tatctaatgatatcaagtttgtcatttggtcatgataatgctattaatgtcttccattat
tttggtgataataacgcaatctcttggacaaccatttcccaatctattagtgattatatt
gttaaaataaacaacttatcaaagacagtgcagcaaagacaacaacaaatagaagataca
acaacaaataacaataataacgaacttgattcaataactgtagcattggatgaagggtta
aacgaagaagcaatcatattcttgtcctcattattaacactaattggatcagtggcgcat
gatgtcgatgaagataccaaggttatattatcaaatacgtttagcaatatattatttgaa
tttgccaaagtggatacacctttaatcggtgcatgttttaaaactttggggcaattagtt
ccagaagaaacttcatcaaaattgaatttatggaggtcactagatactttgattttcaag
actgccactttaacaaatgcaacagattcatataaatctgctttcaaatccatattaata
aattataacgaaatacttggttttttgcaattattcaataatcttttgaagattgaatcc
acatatttgaatacaaatgggttcctaacctttgggaagttatccttcccagcacgtttg
ggccaaggttacagaaaattaggtatttggccatattttgattacattttaaatgacata
tttgtctcctcgcatttaattcctgacagtgataatagaagggctattcaacttccaatc
ctggaaataattgaaacgtcattatattcatttgattattccataattttaaattctctt
ctcatcggtacaaatttggatcaatttggtgcaaacttggatttttttacctacgtgcaa
gaatctcctgctacagtgatttttaatcatctattcacagagaaaatttacaaatcactc
tttaaaataattaatgtgggtgttgaccatctatcaatagatttgggtggaggcagcact
caattgagactaataaagcaaggtattaagatcattaatcttgtcctggaattccaggca
acatttgcagaagagtttgtaaatattattactaaacagaagaataaggaatattattta
ccaaaaaattttggattacatggattaccatcattctacgatgccatattttttaacctc
cccattgtggcccatctgggattatacgttggtttagataattacgatgttgctctggaa
tcattaaacgccttgatcaaattggaaaataatagcccttcaaatgaatcgggctctgca
ggtccaaataaactactcactatttttgacgctgtcgatgattcagcaagaataaaagaa
gcttttatttctcaaattgaagcatccatcgactgtgatgaacaattgacattgaagtat
caaatactgaattttatcgattctatgctatctcttaaagatcaaaaacctactttagca
cactttttattgggtttccaagttacaaacgtcatttctacaggtccagctttgtctaca
ttcatcaattcagatatttctctcttcaagtcggtagcttcattattggaatcttctctc
agtgccatcaactctgaccgtattgcctacgcaccaatacggttggcatcattatcccta
gagattattctaaaactttgttccaaccctctaacttcaaatgtcattttggactatctt
attcatgaccacttctttgaaaggataatacaattagatccacatgttacaaagtttact
ttgtgggaggatttaagttttgattcatctcaaattgacaatggtattgaattcattggt
aagaaaccaatgggcgctctattgtacttcttgacttatagggctcatcttatccaatgt
ctgagtttatttattcacagactatcatttactggaacaaaatctgaaacgcttactcaa
atcaaatacttaatatctaatcaaatatattctaccagaatattttcatttttggatact
ttaaactatggtgctttatcaaataatgaagaactatcaaagcagatcaatattttcaag
aatattccactaaatttggataatattaccatatcagattgtccaagtgatgaaattata
tttgattattctgaattgatgtctatcttaaacttagaagctaaagtatacaagatgtct
aacaaaaatgatgagaaccttcttcaaaacagcgattcaaaacttgttgttgatgttcac
attgaagaagaaattgagttggtcaaactatgtgtggcaagttatttaggacaccaacga
tttatggaagaacaacttcgtattcttcattcatgggtacaattaacacaaattattgtc
actgatggagatttatcctccgtagagcgttccaatttcattttggaagttttcggaaat
atcatcccaaaaatcaatgactatgtcgaattagatgtttctttctccgaagaattaacg
tcgttggcagtgtttctaaacgacatgtatcagaaagatcgtatgcaaatagatggtctt
caagctgttgacagtagactatataatatgttcaaggtttgcctgcatggtattatgtca
ccactttcttcagtgtcattaaaatcagatttttacgtccttacaaatagttatctcgtt
agaactttgaaagaaaaaaagcttgcgaaggaattgctacaagatttaagaatgaataat
gaaaagttggtggaggttatttgtaacgatgtgatttatgttcaaggtgcaggaaagatt
acggggatactattattagattctctcatacaattagggaatttgaataaagaaaacttt
attttaactactctgttgaaaagcacacatttactaagtattgtgcattcattgaaaagt
actgattctatgataacagctaccaaggaaaagattgaaatagatgacctgttatacgaa
ttaactgcattcaaagcaacagtatttttcttaatacgtgtggccggaactaagattggt
gcacatgccttagttcaaagtaaactttttgaagtgcttggtgcttgttctttcctaaat
attgacccagatctagggttagaattggtagctaacgaattctcaaccggaaaatcagat
tttatcagaattaatgtcaacttagattcctcttcttctttggataaaggggtaaataat
atatccttattcgaactaatcgtaccggtcttccaacttttatgctctgttctgataagt
atgggcagtactaacaaatctgtcatccaatcagttcgaaaattgttggtaaagttcagg
aaattattagttggtgtattcaggagagaagcgttaacaaagcagcaagatgccgcgaca
atgaagtatccttcatcacacggattggaagaaatggtcaaattgatagtgatactgtgt
actttaaccggatatcgtggtgaagatacagtacctaacttaatagagtaa

DBGET integrated database retrieval system