KEGG   Naumovozyma castellii: NCAS_0A01870Help
Entry
NCAS_0A01870      CDS       T02233                                 

Gene name
NCAS0A01870
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ncs  Naumovozyma castellii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NCAS_0A01870 (NCAS0A01870)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NCAS_0A01870 (NCAS0A01870)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:361681..362322
Genome map
AA seq 213 aa AA seqDB search
MKALLIIDVQNDFLPPNGSLAVPKGDEIVNPILSLIHDSQQDWHRVVMTRDWHPKNHISF
AKRHGQEPYSSITYKSPRPGDSSTQEGTLWPVHCVQNTRGSQLADPLLKETYKNHYKIVD
KGFLSDREYYSAFNDIWDFHKTELNDYLKKHHITQVYVVGLALDFCVKNTAISAAKLGYE
TIILKDYTRAINSDEESMEKLKKELEEHNIKLQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcattattaattatcgatgtgcaaaacgacttcctcccaccaaacggatcgcta
gcggtccccaagggagacgagatagtgaatccaatcctatccttaatccatgactcacaa
caggactggcatagagtcgtcatgactagagactggcatccaaagaaccacatctccttc
gccaagagacacggacaggaaccatactcatccatcacatacaagtcccccagaccgggc
gattcatccactcaagaaggtaccttgtggcctgtgcattgtgttcagaacaccagaggc
tcacaattggctgatccattgttgaaggagacttataagaaccattataagattgttgat
aaggggttcttgtcagatagggagtattactcggcgttcaatgatatttgggatttccac
aagacagagttgaacgattatttgaagaaacatcatattactcaagtctacgtcgttggg
ttggcgttggatttctgtgtgaagaacacagccatctcagccgccaagttgggctacgaa
actatcatcttgaaggattatacgagagcaatcaattccgatgaggagtccatggagaaa
ttgaagaaggagttggaagagcacaatatcaagttgcaatag

DBGET integrated database retrieval system