KEGG   Naumovozyma castellii: NCAS_0A01900Help
Entry
NCAS_0A01900      CDS       T02233                                 

Gene name
NCAS0A01900
Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ncs  Naumovozyma castellii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCAS_0A01900 (NCAS0A01900)
Enzymes [BR:ncs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NCAS_0A01900 (NCAS0A01900)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCAS_0A01900 (NCAS0A01900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:367001..368023
Genome map
AA seq 340 aa AA seqDB search
MHKAEFLDIDQTEISSVLAGGYNHPLLREWQSERQLSKNMLIFPLFISDNPDESTPIESL
PNIKRFGVNKLSEYLKPLVAKGLKSVILFGVPLKAGIKDEFGTAADDPEGPVIQGIKVLR
ENFPDLYIACDVCLCEYTSHGHCGVLLPDGTIDRERSVARIAAVAVNYAKAGANCVAPSD
MIDGRIKEIKRGLINAKLAHKTFVLSYSAKFSGNLYGPFRDAACSSPSAGDRKCYQLPPA
GRGLARRALKRDLNEGADGIIIKPSTFYLDIMREASDICADLPICAYHVSGEYAMLHAAA
EKGIVDLKTIAFESHQGFLRAGARLIITYFAPEFLEWLDN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagctgaatttctagacatcgaccaaaccgaaatttcctccgtactcgctgga
ggttacaaccacccattactaagagaatggcaaagtgaacgtcaattatccaaaaacatg
ttgatcttccctcttttcatctcagacaatcctgatgagagtaccccaatcgaatctctc
cccaatataaagagattcggtgtgaacaaattatctgagtatttgaaaccattggtcgct
aagggattgaaatctgtcatcttgttcggtgtgcctttgaaagccgggatcaaggatgag
tttggtaccgcggcagacgatccagagggaccagttattcaaggtatcaaagtcttacgt
gagaacttccctgatttgtatatagcctgtgacgtttgtctttgtgaatatacttctcat
ggtcattgtggtgttctattacctgacggcacaatcgacagagagagaagtgtggctaga
atagccgcagtagctgtaaactatgctaaggctggtgccaactgtgtggctccaagtgat
atgatcgatggaagaattaaagaaattaaacgtggtttgattaatgctaagttggcacat
aaaacattcgttttgtcttattcagctaaatttagtgggaacttgtatggcccattccgt
gatgcagcttgttcttctccatcagctggggatagaaaatgttatcaattaccacctgct
ggacgtggattggcccgtagagcactaaagagggatttgaatgaaggtgctgatgggatc
atcatcaagccttctacattttatttagatattatgagagaagcaagtgatatttgcgct
gatttacccatctgcgcataccatgtatctggtgaatatgctatgcttcatgctgctgct
gaaaagggaattgttgatttgaagacaatcgctttcgaatcccatcaagggttcttgaga
gctggtgccagattgatcatcacatattttgccccagaattcttggaatggttagataat
taa

DBGET integrated database retrieval system