KEGG   Naumovozyma castellii: NCAS_0A02710Help
Entry
NCAS_0A02710      CDS       T02233                                 

Gene name
NCAS0A02710
Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ncs  Naumovozyma castellii
Brite
Protein phosphatases and associated proteins [BR:ncs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NCAS_0A02710 (NCAS0A02710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(519241..519716,519820..519871))
Genome map
AA seq 175 aa AA seqDB search
MGAAPSRIVDNLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSANPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKNEKLKFAFKIYDIDKDGLISNGELFIVLK
IMVGSNLNDEQLQQIVDRTIMENDLDGDGHLSFEEFKSAIETTEVAKSLTLEYDV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgctccttctagaatagtggacaatctactcgaggatacaaactttgatagg
gatgaaatcgaacgattaaggaaaagatttatgaaattggatagagatagttcaggttcc
atagataaaaatgaatttatgagtatccctggtgtttcagcaaatccactagctggacgt
ataatggaagtatttgatgctgataatagtggtgatgtcgatttccaagagtttattaca
ggtttatctatatttagtgggagaggaagtaagaatgagaaattaaaattcgctttcaag
atatatgatatagataaagatggattaatatctaacggggaactatttattgtactaaag
attatggttgggtcaaatctaaatgatgagcagttgcaacaaattgtagacagaactata
atggagaacgatttggatggagatggacatctaagctttgaagagtttaaaagtgccatt
gagactacagaggtggctaagagcctgactcttgagtacgatgtataa

DBGET integrated database retrieval system