KEGG   Naumovozyma castellii: NCAS_0A02850Help
Entry
NCAS_0A02850      CDS       T02233                                 

Gene name
NCAS0A02850
Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCAS_0A02850 (NCAS0A02850)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCAS_0A02850 (NCAS0A02850)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:542807..547669
Genome map
AA seq 1620 aa AA seqDB search
MSTTNKNSFNQSVDNQENNTIPSDGPSAGLPEQLITQNQDWLLSSIANFTWIIMYFFMGT
TMSLMRAIWYMITIVILRSSTWILFSTNKLQFTVSLSVFIVMSAIIVYITYCVVRARILS
QYKKLTPDNDDFVMNQNNIHSGLSDSATQRDHMHYKNERKSSNQEDDTFLSSYLDQFLSA
IKIFGYLEKPVFHDLTKNMKTQKLDEGEILLLDNSIGFAIVVEGTLQVYHEVEEKSSEPM
VMDTTNHVGFMSSSETNAKGDDGLSNSQVISDTADDSSIETDGDDDDDDDDDDDSDEELG
YIRLKNGLGRFQLLNTVKPGNPVSSLVNILNLFTTAANNDLFNANIIKKNRGDSNELNLT
LRKFIIDADKNDNNIPFDATPPPPLLSQQSPSLSPSNNNLPDVSLSDSMPKVVGVAATDC
TIAIIPPQAFAKLTAKYPRSASHIIQMILTKLYNVTLQTAHNYLGLTKEIMNIELTLNKS
VNYEIPYYLKEAVMRKFSNKDKPIVNERKSYETSMPNFEKRPSSFDIPSSPTSKQSSNLN
LKSPVASKSNRNSIILGSRHVVLDSRDHFNPGDLLSNVPLSRKETMNEISTRRRKSPLQK
SSHHALSAAFIEKEVPKRPNLKNKDTSTDFREIRKQTNNIIDRSFSSIQEETEESAVRMA
IVEALFGFLGINKDNMSLYQTNTNQSNGNFPNTHRSSEISLVTSFESSSTPRTTLRILPS
HYTIQTKKQMKKNKNKKTYKEEVFSNLDFESAKSSFMQGIKLQFFKQGTRIVEQNSNGKG
MFYVIAGKIDVTTTNEDELQVLSSGSKQKKQLEHHLFTVSNGGIAGYLSSVIGYKSFVNL
NARTDVYVGFLPNDTLENLCDKYFLIYLRIAETLTSMLSTKLLKLDHALEWIHLTASETL
FKQGDPANGIYVVLNGRLRQLQDHRHENNDINKTIKRQQEGQGSVRNDDETYEVILGEHA
QGESFGEVEVLTAMDRISTIVAVRDSELVRIPRTLFELLALEHPSIMIRVSRLVARKILS
NNSSEVNQNPLASTSKFNLTIPTANSLITSNSYNGKQNTTSGSITFRTITILPIREGLPV
ELFAMKLVQAFKQVGRTTIGLNQRTTLTHLGRHAFDRLAKLKQSGYFAELEEMFQTVVYI
ADTPSQSSWTKTCIAQGDCILLLADANSSPDIGEFENLVLKSKTTARTGLILLHPERYVE
PGLTQKWLRYRPWVHSHHHIQMAVNSLESISVLKTSGLNGGALALMDKLIQTEFSRKTQQ
NISRLLPDSIKSKVENFSGRFMRRRNKQFYTPTHMHKNDFLRLARILSGQAIGLVLGGGG
ARGLSHLGMIQAIEEQGIPIDMIGGTSMGSFVGGLYAKDYDLVPIYGRVKKFAGRLSSIW
RTLSDLTWPVTSYTTGHEFNRGIWKTFGETRIEDFWIQYYCNSTNITDSVQEIHSFGYAW
RYIRASMSLAGLLPPLEENGSMLLDGGYLDNLPVSEMKLRGCNTIFAVDVGSVDDRTPMK
YGDSLNGFWIVFNRWNPFSTHPNIPNMAEIQVRLGYVASVNALENAKNTPGVIYIRPPID
NYATLDFGKFEEIYGVGVDYGRVFFQELETEGNMPKLPGCQNDYFDTKVSELLLHRRNSI
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaactaataagaattcatttaaccaatccgtagataaccaagaaaataatact
ataccttcagatggacctagcgcaggccttccagaacagttgataactcaaaatcaagat
tggctgctttcatccattgcgaatttcacatggatcataatgtacttctttatgggcact
acgatgtccttgatgagggctatatggtacatgataacaattgtcatattgagaagttcc
acctggatcttattttccacaaacaaacttcaattcacagtctctttgagtgtcttcatc
gtcatgtccgccatcatagtttatatcacatattgtgttgtaagagcaagaatcttatct
caatataagaaattgactccagataatgacgattttgtaatgaatcaaaataatattcat
tcagggctgagtgactctgccacacaaagagatcatatgcattacaaaaatgagagaaaa
tcaagtaaccaagaggatgatacctttttatcgtcgtatctggaccaatttttaagtgcc
atcaagatattcggttatctggaaaaacctgtctttcatgatttaaccaagaatatgaag
actcaaaaattagatgaaggcgagatattattactcgataattctattgggtttgccata
gttgttgaggggactttacaagtttaccatgaagtggaggaaaagtcaagtgaacctatg
gtgatggacaccactaatcatgtaggtttcatgtcttcttcagaaaccaacgcaaagggc
gatgatggtctttcgaattcacaagtaatctctgatactgctgacgacagctctatcgaa
acagatggtgatgatgacgacgatgacgatgacgatgacgatagtgatgaagaattagga
tatattcgtttgaaaaatgggttgggcaggtttcagttgctgaatacggtgaaacctggt
aatcctgtatcatctctagtaaacattttaaatttattcaccactgcagccaacaatgac
ttatttaatgctaatattatcaagaagaatagaggagattcaaatgaactgaatcttact
ttgagaaaattcattatagatgcagacaaaaacgataataatattcccttcgatgccact
ccaccacctccacttttatctcaacaatcacctagtttatcaccttcaaataacaactta
ccagatgtatcgttatctgattccatgcctaaagttgttggtgttgcggcaacagactgt
acaattgctataatcccacctcaggcattcgccaagttgactgcaaaataccctagatct
gcatcgcatattatacaaatgattttaaccaaactttataatgtgacattacaaacagca
cataattatcttgggttgacaaaggagattatgaacattgagttgactttaaataaatct
gtcaattatgaaattccctattatttgaaggaagccgtaatgagaaagttttccaacaaa
gataaacccattgtaaatgaaagaaagtcgtatgaaacatcaatgccaaattttgaaaag
agaccttcaagttttgacattccatcatcacccacctccaaacaatcatccaacttgaat
ttgaaatcacctgtagcttcgaaatctaatcgtaattcgattatattaggatcacgacat
gtggtgctagactcaagagaccattttaatcctggagatttattatcaaatgtaccatta
tctagaaaggaaacaatgaatgaaatttcaactcgtagaaggaaatctccattacaaaag
tcaagccaccatgcattatctgctgcatttattgaaaaagaagtcccaaagcgcccaaat
cttaaaaataaagatacttccacagatttcagggaaattagaaagcagaccaataatatt
atagatagatcattttcttctattcaagaagaaacggaagaatcagctgtaaggatggct
attgttgaagctctatttggtttcttaggaattaacaaagataatatgtccttataccag
acaaacactaaccaaagtaacggaaattttcccaatacccatcgttcatctgaaatatca
ctagttacttcattcgagtcctcatctacgcctcgaacaacattaagaattttgcctagt
cattataccattcaaacaaagaaacaaatgaagaagaataaaaataaaaaaacttacaag
gaagaagttttttcgaatctcgattttgaatcagccaagagctccttcatgcaaggcata
aaattacagttttttaaacaaggtactcggattgtggaacaaaattccaatgggaagggt
atgttctatgtcatagcagggaaaatcgatgtaacaacaaccaatgaagatgaactccaa
gtactttcctcagggtcgaagcagaaaaaacaactagaacatcatttgttcacagtttca
aacggtggaatcgctggatatctatcatctgtaattggatataagtccttcgtaaatttg
aatgcccgtaccgatgtctatgttggatttttgccaaacgatacactggaaaatttatgt
gacaagtattttttgatatacttgagaattgctgaaacattaactagtatgctgtccacg
aagttgctgaaattagaccatgcgcttgaatggattcatttgactgcttctgaaacactc
ttcaaacaaggggatcctgcaaacggtatttatgtggttttgaatggtagactaagacaa
ttacaagaccatcgtcatgaaaataatgatataaacaaaactatcaaaaggcagcaagag
gggcaaggctctgtacggaatgacgacgagacttacgaagttatccttggagaacatgcc
caaggagaaagttttggagaagttgaagtcttaacagcaatggatagaatatccaccatc
gttgcagtaagagattctgagctggtacgtattcctagaaccttatttgaacttttggca
ctagaacatccatccatcatgatccgtgtttcaaggttggttgcaagaaagatattgagt
aacaattcttcagaagtgaaccaaaatccattagcatccaccagcaaatttaatttaaca
attccaacagctaatagtctcatcacatcaaattcatacaatggtaaacagaatacgaca
tctggatctataactttcagaacaattacaattctaccaatcagggagggattacctgtt
gagttattcgccatgaagttggtacaagcttttaagcaagtaggtcggactaccattggt
ttgaatcaaagaactacattaacacatcttggtcgtcatgccttcgatagattggcaaag
ttgaagcagagtggttactttgcagaactggaggagatgtttcaaacagttgtttatata
gcagacacaccaagccaatcgagttggaccaaaacctgtattgcgcaaggggattgtatt
cttttgctagcagatgctaattcctccccagatattggggaatttgagaatcttgtttta
aaatcaaaaacaactgcaagaaccggattgattctactccacccagaacgttatgttgaa
ccaggacttactcaaaaatggttaagatacagaccttgggttcactcacaccaccatatt
caaatggctgttaattcattggaaagcatttctgtactcaagacatctggccttaatgga
ggagcattagctttaatggataaattaattcaaacagaattcagtcggaaaacgcagcaa
aatatatcgagattacttcctgactccataaaaagtaaggtcgaaaacttttctggccgt
tttatgaggaggaggaataaacagttctacacaccaactcatatgcacaagaatgatttt
ttacgattagctagaattttatcaggtcaagctattggtttagttcttggaggtggaggt
gcaagaggtcttagtcaccttgggatgatacaagccattgaagagcaaggtattcctatt
gatatgattggtggaacttcgatgggttcgtttgttggtggcttgtatgcaaaagactat
gatttagttccaatatatggccgtgttaaaaagtttgccggcagactttcttcaatttgg
agaaccctttctgatctaacctggcccgtaacttcatacaccactgggcatgaatttaat
cgtggtatctggaaaacatttggggagacgagaattgaagatttctggattcaatattat
tgtaattcaactaatatcacagattcagtgcaagagatccattcattcggttacgcttgg
agatacattagggcgtcgatgtcccttgctggtttgttacctccacttgaagaaaatggt
tctatgttattagatggtggttatctggataatttacctgtttcagaaatgaaattacgt
ggatgtaatacaatttttgctgtagatgtcggttccgttgatgatagaactccgatgaaa
tatggtgattcactaaatggattctggatcgtttttaatagatggaatcctttttcaacc
catcccaatatccccaacatggctgaaattcaagtcagattgggttatgtagcctcagta
aatgccttggaaaacgcaaagaatacacctggagtgatatacataagaccaccaattgat
aattatgccaccctagattttggaaaatttgaagagatttacggcgttggtgtagactat
ggtagggtattctttcaggaactagaaaccgaggggaacatgcccaagttaccaggttgt
cagaatgattactttgacacaaaggtatctgaattactattgcatagaaggaatagtatt
tga

DBGET integrated database retrieval system