KEGG   Naumovozyma castellii: NCAS_0A03640Help
Entry
NCAS_0A03640      CDS       T02233                                 

Gene name
NCAS0A03640
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCAS_0A03640 (NCAS0A03640)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCAS_0A03640 (NCAS0A03640)
Enzymes [BR:ncs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCAS_0A03640 (NCAS0A03640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:727694..729358
Genome map
AA seq 554 aa AA seqDB search
MLIIKRFQHNSSSSGYPMRRFFENETSELKAWWDSPRFANVKRPYQPIDVIKHRGSMPLS
ATHYPSSYQAGKLFKLLQENFQNKTPLHTLGVIDPVQMTQLSRCEQLKVVYLSGWACSST
LVTPSNEVSPDFGDYPYTTVPNQVERIFKAQQLHDRKAFLESFESKTDKMVDYLKPIIAD
GDMGGSPNMCMKLAKLFAEKGAAAIHLEDQLLGGKRCGHLGGAVIVPTGDQLSRLVATRF
QWDIMGTENLIIARTDSCNAKLLSSSSDPRDHEFIKGVIDPNLTAWSEELIDMETTNTER
SIIQERELKWYNNNQLMTFDEAVEMKFNNEEYKQYLTTKKHMMDKELKRPYLSLSELKMI
AKRVSPSKEIYFNWDIPRTKEGYFMFKGCMEAATRRSLVFAPYSDMTWLETKTPDLVQAK
DFARNIHDVYPWVKLVYNLSPSFNWTQNGFSETELKSFIWDLAKEGFILQLVSLAGLHVN
ALSFWELAQGFQSGGMDAYVKQIQQREKETDCDVLTHQKWSGAEYIDSVLQVIQNGSSSH
TSTTSGESYTESQF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcattaaacgtttccaacacaattcctcctcttcgggataccccatgagacgc
ttttttgaaaatgagactagtgaattaaaggcatggtgggattctcctagatttgctaat
gtcaaaagaccataccaaccaatagatgtgattaagcatcgtggatccatgcctttatca
gcaacgcactacccgtcgtcgtatcaagcagggaaactattcaaactacttcaagaaaat
ttccaaaataagacaccattgcatacattaggggtgatagacccagttcaaatgacacaa
ttatcgcgttgtgagcaattgaaagttgtctatttatctggatgggcctgctcttcaact
ttagtgactccctctaatgaagtctcccctgactttggcgattatccgtacactactgtc
cctaaccaagtagagagaatattcaaagctcaacaattacatgatagaaaagcttttcta
gaatctttcgaaagcaaaactgataaaatggttgactatttgaaaccaatcattgccgat
ggtgatatgggtggaagccccaatatgtgtatgaaattggctaagttatttgctgaaaag
ggagctgctgctatacatttagaagatcaattactgggcggcaaaagatgtggacattta
ggtggtgcagtcattgtccccactggcgaccaactgagtagattggttgcaactagattt
caatgggatattatgggaactgaaaatttaattattgctagaacagattcttgtaatgct
aaattattaagcagttccagtgatccaagggatcatgagttcattaagggtgtgattgac
cccaacttaacagcatggagcgaagaacttattgatatggaaactacaaatactgagaga
tccattatacaggaacgtgaattgaaatggtataataataatcaattaatgacgtttgat
gaagctgtcgagatgaagtttaataatgaagagtataaacaatatctgacgacgaagaag
cacatgatggataaagaattaaaaagaccttatttaagcttgagtgaattgaagatgatt
gccaaaagggtttcaccttcgaaggaaatttactttaattgggatattccaagaacaaaa
gaaggttatttcatgttcaaaggttgtatggaagcagctactagaagatccctggtattt
gcaccatattctgatatgacttggttggagacgaaaacacctgatctggtccaagctaag
gattttgctagaaatatccatgatgtttacccttgggtgaagttagtctacaatttatct
ccaagttttaattggactcaaaatgggttctctgaaacagaactaaagtcattcatatgg
gatcttgccaaggaaggatttattctacaattagtgtcacttgccggtctacacgtcaat
gcactgtctttctgggaacttgcacagggattccagtctggtgggatggatgcttatgtc
aaacaaattcaacaaagagaaaaggaaactgattgtgatgtacttactcaccaaaaatgg
tctggagctgaatatattgactctgtacttcaagtaatccaaaatggttcttcctctcac
acctctactacgtctggggaaagctatacagaaagtcagttttga

DBGET integrated database retrieval system