KEGG   Naumovozyma castellii: NCAS_0A05070Help
Entry
NCAS_0A05070      CDS       T02233                                 

Gene name
NCAS0A05070
Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ncs  Naumovozyma castellii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NCAS_0A05070 (NCAS0A05070)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     NCAS_0A05070 (NCAS0A05070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1009748..1011025)
Genome map
AA seq 425 aa AA seqDB search
MSDPSPSLPPLRPMTSSSKLSVRTAAKTRARRTSSVGRIDLGDTVSGLGTMFETKESKAA
SMKRMHELTQASRNDKDLIKKFWLSFREMNYRHTWITPLIIMVIVYSAYFTSGNRTCTNP
LHMFVAVSYQVDDTDEYAKGIKDLCFVFYYMIFFTFLREFLLDVVLRPIPDILHANSKHK
SKRIIEQMFYIVYYGFSAPFGLYVMYHSNLWLFKTAPMYETYPDLTNPFLFKVFYLGQAA
FWAQQACVLVLQLEKPRKDHQEMIFHHIVTLLLVWSSYVFHFTRIGLAIYITMDISDFLL
SLSKIFNYLDSPFTPPVFFIFVTTWIYLRHYINIKILWSVLTEFRTVGDYVLDFATQQYK
CWISLPIVFTLIAALQLVNLYWLFLIFRILYRMVWKGIVEDTRSDTESESEESMTPTDSN
AKKNF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacccctctccgtcgctaccaccactaagaccaatgacctcttccagcaagctc
tccgtcagaactgctgccaagacaagagccaggcgtacgtcctctgtcgggagaatcgac
ttgggtgacacagtctctggtcttggaaccatgttcgaaacgaaggagtccaaggcggcc
tctatgaagagaatgcatgaactgactcaagcatccagaaacgataaagatctaatcaag
aaattttggctctcattcagagaaatgaactatcgtcacacatggattacacctttgata
ataatggtcatcgtctatagtgcctacttcacctccggtaatagaacgtgcacaaaccca
ttgcatatgttcgtcgccgtgtcttatcaagtcgatgacacggatgaatatgctaagggt
attaaagatctttgtttcgtgttttattacatgatattcttcacgttcttacgtgaattc
ttattagatgttgtattgagacccatcccagatatattgcatgctaattccaagcataag
agtaaaagaatcattgaacaaatgttctatatcgtctattatgggttttcagccccattt
ggattatacgtcatgtatcattccaatctttggctattcaagactgcccccatgtatgaa
acataccctgatttgacaaatccattcttatttaaagtcttttacttgggtcaagctgca
ttctgggcacaacaagcatgtgtattggttcttcaattggaaaaaccaagaaaggatcat
caagaaatgatcttccatcacatcgtcactttactattagtttggtcatcatacgtgttc
cacttcactagaatcggtctagcaatctacatcaccatggacatttcggatttcctatta
tcattatccaagatcttcaattatttggattcccctttcacaccaccagtattcttcatc
ttcgtcactacgtggatttacttgcgtcattatatcaatatcaagatattatggtccgtc
ttgacggaatttagaactgtcggagactacgtattggatttcgccactcaacaatacaaa
tgttggatctctttacccatagtgttcactctcatcgctgctttgcaactagttaacctg
tactggctattcctgatctttagaatcctttatagaatggtatggaagggtatcgtggag
gatacaagaagtgatacggaatcagaatcagaggaatcaatgactccaacggacagcaat
gccaagaagaacttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system