KEGG   Naumovozyma castellii: NCAS_0A06680Help
Entry
NCAS_0A06680      CDS       T02233                                 

Gene name
NCAS0A06680
Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ncs  Naumovozyma castellii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ncs04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1320265..1321704
Genome map
AA seq 479 aa AA seqDB search
MTEKMERHSFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVF
SKSLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIK
SSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVD
QLTRILQVLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDANPQALDLLEKMLA
FDPQKRITTDEALEHPYLSIWHDPSDEPVCSEKFEFSFEAVNDMDELKKMVIEEVRDFRK
FVRQPLLEEQKQKQQQQQQQQQQQQQQQEISHNSSMEGTMEENDFSNQMGFQSPNVVGID
SQGLPKHDTDFPPRPQENLLASPAALKSNSDPSQMATNDNDDFFDLEKELEFGLDRKYL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaagatggaaagacacagcttcaaggtattcaaccaggacttcactgttgat
aaacgattccaacttattaaggagatcggtcatggtgcatacggtattgtttgttccgca
cgttttgcagaagctgtagaagacaccacggtggccattaagaaggtgactaatgtgttc
tctaaatctctgctatgtaaaagatctttacgtgaattgaagctgttgagacatttcaga
ggccataagaacattacatgtctttacgatatggatattgtattctaccctgatgggaca
tttaatggtctttatttatatgaagaacttatggaatgtgacatgcatcaaattattaaa
tctagtcaaccattgacagatgcacattatcaaagttttatttatcaaatcctttgtggt
ttgaaatatatccattctgcagatgtgttacatcgtgatttgaaaccaggaaatttgttg
gttaatgcagactgtcagttgaaaatttgtgattttggtcttgctagagggtattctgaa
aatccagtggagaataatcaatttctcacggaatatgtggcaaccagatggtaccgtgct
ccggaaatcatgttaagttaccaaggatatactaaggctattgatatatggtctactggt
tgtattttagcagaattcttaggtggtaagccaatatttaaaggtaaggattatgtggat
caattgacccgaatattacaagttcttggtacaccaccagatgaaactttaagaagaatc
ggttctaaaaatgttcaagactatatccatcaattaggatatattcctaaggttccattt
gtaaacctctatccagatgcaaatccacaagcacttgatttactagagaaaatgcttgca
tttgatccacaaaagagaattacaactgatgaagccttagaacacccatatttatcaata
tggcatgatccatcagatgaacctgtatgtagtgagaagtttgaattcagttttgaagct
gttaacgatatggatgaactgaaaaaaatggttattgaagaagtacgtgatttcagaaaa
tttgtaagacaacctcttcttgaagaacagaaacagaaacaacaacaacaacagcagcag
caacaacaacaacaacaacagcaggaaatatctcataatagttccatggaaggaacaatg
gaagagaatgatttttcaaatcaaatggggttccaatctcctaatgttgttggtattgat
tctcaaggcttacccaagcatgatacagattttccaccaagaccacaagaaaatttatta
gcgtcacctgcagccttgaaatctaattctgatccttcgcaaatggctaccaatgataat
gatgactttttcgatttagagaaggaattggaatttggactagatagaaaatatttataa

DBGET integrated database retrieval system