KEGG   Naumovozyma castellii: NCAS_0A07780Help
Entry
NCAS_0A07780      CDS       T02233                                 

Gene name
NCAS0A07780
Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ncs01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ncs00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ncs00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ncs00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1548197..1549318
Genome map
AA seq 373 aa AA seqDB search
MLRFTNTRTLQQTSLMKSFLRLQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEIL
INVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLN
GSCMSCELCESGHESNCEHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCA
GITVYKALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMGYRVIGIDGGPGKEELFKSLG
GEIFVDFTKTKDIVAEIQEATRGGPQGVINVSVSEAAISLSTKYVRPTGTVVLVGLPAHS
YVKSEVFSHVVKSINIKGSYVGNRADTREALDFFARGLIKSPIKIIGLSELPNVYKLMEE
GKILGRYVVDTSK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttacaaatacaagaactttgcaacaaacttctctcatgaaaagtttccta
agactgcaatccacagttaccattcccaagatgcaaaaaggtgtgatcttctacgagaca
ggtggccccctacactacaaggacatccctgtccccaaaccaaaggctaacgaaattctg
atcaacgtcaaatattcaggtgtctgtcatacggatttgcacgcttggaagggggactgg
ccattagctactaaattacctctagttggtggtcatgaagggtctggtgaagtggtggcc
atgggggagaacgtgaagggatggaagattggggatttggccgggatcaaatggttgaat
gggtcttgtatgtcttgtgaattatgtgaatcaggtcatgaatccaactgtgaacatgct
gatttgtccgggtacactcatgatgggtcattccaacagtatgccactgcggatgccgtg
caggctgctagaattcctaagggaaccaatatggctgaagtagcacctatcttgtgtgct
ggtatcacagtttataaggctttgaaagaagctgacatgagagctgggcaatgggtttgt
atctccggagctgcaggtgggttagggtccctagcagttcaatatgctaaggctatgggt
tacagagtcattggtattgatggcggtccaggcaaggaagaattgttcaaatctcttggt
ggagaaatctttgttgatttcaccaagaccaaggatatcgttgccgaaattcaagaagcc
actagaggtggtccacaaggtgtcattaacgtctctgtctcagaggctgccatctctttg
tccactaagtatgtgagacccaccggtaccgttgttcttgttgggttaccagctcattct
tacgtcaagtctgaagtgttctctcacgttgttaaatccatcaatattaagggttcctac
gtcggtaacagagcagacactagagaagctctagatttttttgccagaggattaataaaa
tccccaattaagatcattggtctatccgaattgccaaacgtctacaagctaatggaggaa
ggtaaaatcttgggtagatacgttgtggacaccagtaaatag

DBGET integrated database retrieval system