KEGG   Naumovozyma castellii: NCAS_0A08870Help
Entry
NCAS_0A08870      CDS       T02233                                 

Gene name
NCAS0A08870
Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ncs  Naumovozyma castellii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0A08870 (NCAS0A08870)
Enzymes [BR:ncs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NCAS_0A08870 (NCAS0A08870)
Glycosyltransferases [BR:ncs01003]
 Polysaccharide
  Storage polysaccharide
   NCAS_0A08870 (NCAS0A08870)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1753849..1755966
Genome map
AA seq 705 aa AA seqDB search
MARDLQNHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDNYHLIGPLNKATYQNEVDQ
MDWEAPDSFPDEIKPIQSTLRSMRSRGVNFIYGRWLIEGSPRLILFDLDSVRGFLNEWKG
DLWYLVGIPSPENDFETNDAILLGYTVAWFLGELTAEDTTHAIIAHFHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLENFDVDHEAGKRGIYHRYCVERAAAHT
ADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAVHEFQNLHALKKEKINEFVRGH
FHGCFDFDLDNTVYFFIAGRYEYKNKGADMFIESLARLNYRLKVAGSKKTVIAFIIMPAK
NNSFTVEALKGQAVVKALETTVDEVTNSIGKRIFDHAMRFPNNGTTSEIPVDIHELLKPS
DNVLLKKRVLGLRRPAGELPAIVTHNMVDDANDPILNQIRHVQLFNGSSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPDQFKQLVGEELNDTNMDTLAGGKKLKIARPLSVPGSPRETR
QASAIYMTPGDLGTLQEANTADDYFNLSIGSHDGDDEQGPYADEN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgacctgcaaaaccatctccttttcgaaacggccacagaagtcgccaatagg
gtcggtgggatctactccgtccttaaatcaaaggcacccatcacagtagcacaatacaag
gacaattatcatcttattggtcctttaaataaggccacttaccagaatgaagtggaccaa
atggactgggaagcaccagactcattccctgatgaaattaaacccatccaatccacttta
agatcaatgagatcccgtggtgtcaatttcatatacggaagatggctaatcgaaggttcc
cctcgtttgatccttttcgatttagattcagttagaggatttcttaatgaatggaagggt
gacttgtggtatctagtgggtatcccttcccctgaaaatgattttgaaactaatgacgct
atcctattgggttacacggtggcatggttcctgggggaattgactgcagaggatactacc
catgccattattgcccattttcatgaatggttggctggtgttgctttacctctatgtaga
aagagacgtattgacgtcgtgactatttttactactcatgctaccttgttaggtagatat
ctttgtgcagccggggacgtcgatttttataacaatttggaaaacttcgatgtggatcat
gaagcaggaaagagaggtatttatcatagatattgtgtcgaaagagctgcagcacacact
gcggatgtgtttactacggtctctcaaattactgccttcgaagctgaacatttgttgaaa
agaaaaccagatggtattctacccaatgggttgaatgtgattaagttccaagctgtgcat
gaattccaaaatttacacgccttgaagaaggaaaaaattaatgaatttgttagaggtcat
ttccatggttgcttcgatttcgatttagataatacagtatatttcttcatcgctgggaga
tacgaatacaagaataagggggcagatatgttcattgaatctctggctcgtttgaattat
agattaaaggtggcaggttctaagaagactgtcattgcattcattatcatgccagcaaag
aataattcatttactgtggaagcattaaagggtcaagctgttgttaaagctttagagact
actgtcgatgaagtgacaaattctatcggaaagagaatattcgatcatgcaatgagattc
cccaacaacggtaccacttcagaaattccagtggatatccatgaactattgaaaccatca
gataacgttcttttaaagaaacgtgttcttgggttaagaagacctgcaggtgaattacca
gctattgtcacacataatatggttgatgatgctaatgatccaatcttaaaccaaattaga
cacgtgcaattgtttaacggttcttcagatcgtgttaaagttatattccatccagaattc
ttgaatgcaaataatccaatcctgggtttagactatgatgaatttgtaagagggtgtcat
ttaggtgtattcccctcctattatgaaccttggggttatactccggcagaatgtaccgtc
atgggggttccatccattacaactaacctttcagggttcggtgcatacatggaagattta
attgaaacaaatcaagctaaagattatggtatttacattgtggaccgtcgttttaaggca
cctgacgaatctgtagaacaattagtcgattatatggaagaattcgttaagaagactaga
agacaaagaattaaccaaagaaatagaacggaaagattatctgatctattggattggaaa
cgtatgggtttagaatacgtaaaggcaagacaattggcactacgtagagcgtacccagat
caattcaaacaattggtaggtgaagaactaaatgacacaaatatggatactttggccggt
ggtaaaaaattaaagattgccagaccgttaagtgtgcccggttctcctcgtgaaacaaga
caggcaagtgccatatatatgacgcctggtgatttaggtaccttacaagaggccaacact
gctgatgattatttcaatttaagtatagggtcccatgatggcgatgacgagcaaggccca
tacgccgatgaaaattag

DBGET integrated database retrieval system