KEGG   Naumovozyma castellii: NCAS_0A09750Help
Entry
NCAS_0A09750      CDS       T02233                                 

Gene name
NCAS0A09750
Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ncs  Naumovozyma castellii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ncs04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1940202..1942370
Genome map
AA seq 722 aa AA seqDB search
MMSTDSFSKLSIADVSDTRDGQMMDEQTEQTTTTTPAVRRTSSPVINETAAAAATVTTPT
GSIHSNGTPNVKRTSSTSSNYDNINANLHARVKAFQEQRALKRSASIGSNKSDHNESAQT
ADQQQQQQQQQQQGTKNIQHIVNKPLPPLPPMNMLNTSPKAATAEVKSSHRISMTIETTS
TIEKNVEQQQQQQQREIKQIDERNIRIRQQRQQHNIEYPLPPPTNMAQFNPSRRAPRLPV
NVHAVSGSAPPPITSSTLPNRPVKQSLSARRGLKLPPGGMSLKMLNKPSLSLSSSSSSLS
QTSEEFSASPSNKTHKGGKHSNPGSLINGVQSTATSSSNNEQHDTKGTTPPQQNNCNNSS
LGSGSGGSGGLFANFAKYVDIKSGSLNFAGKLSLSSKGIDFSNGSSSRITLAELEFIEEL
GHGNYGNVSKVLHKPTNVIMAMKEVKLELDEAKFRQILMELEVLHKCKSPYIVDFYGAFF
IEGAVYMCMEYMDGGSLDKIYDQDPEIGGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDV
KPTNILCSAKQGTIKLCDFGVSGNLVASMAKTNIGCQSYMAPERIKSLNPDIATYTVQSD
IWSLGLSILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQK
VPERRLNYTALLEHPWLVKYRDVDVGMSEYLTTRKELKKRILAEKGNDNLPKKVPALHMG
GL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaccgactccttctccaagctatcaatagcagacgtatccgacacaagggac
ggtcaaatgatggacgagcaaacagagcaaactacaacaacaacgcctgctgtgagaaga
acttcttccccagtaattaacgaaacagcagcagcagcagcaacagtaacaaccccgaca
ggctctatccattccaatggaactccaaacgtaaagaggacatcctccacatcctcaaac
tacgacaatattaatgcaaacttgcatgcaagagtcaaggcgtttcaagagcagagagct
ttgaagagatccgctagtattggaagtaataagagtgatcataatgaatctgcacagact
gccgatcaacaacagcagcagcagcagcagcagcaacaaggaacaaagaatatacagcat
atagtcaataaaccactgcctccgttgcctcccatgaatatgctgaatacatcgccgaag
gctgctacggcggaagtcaagtcgtctcacaggatatcgatgaccatcgagacaacctcg
actattgagaaaaacgttgagcaacagcagcagcagcaacagagagaaattaaacagatt
gatgaaagaaacataaggataagacaacaaagacaacagcataacattgaatatccactc
ccacctccaacaaacatggcacaatttaacccaagcagaagagcccccaggctccccgta
aacgtacatgctgtaagtggttctgcacctccaccaataacatcatccactctaccgaac
cgtcccgtgaaacaaagcttaagtgctcgacgtgggttgaaactaccaccggggggtatg
tcgttgaaaatgttaaataaaccatcattatcgttatcttcatcttcatcatccctatca
caaacatcagaagaattctcagcatcaccttcaaataagacgcataaaggtggtaaacat
tccaatccaggttctttaatcaacggtgtacaaagtacagccacctcttcaagtaataac
gaacaacatgacacgaagggaactactcctccacaacaaaataattgtaataattcctcc
ctcgggtccggcagtggtggttcaggtggtctctttgccaatttcgccaaatatgtagat
attaaatccggttcactaaactttgcaggaaaattatcattatcctccaaggggatcgat
ttcagtaatggttcaagttcaagaatcacattggcggaattggaattcattgaagaattg
ggtcatgggaattatgggaacgtatccaaagtgttacataaaccaacaaatgtcatcatg
gcaatgaaagaagtcaaattggaattggatgaagccaaatttagacaaattttaatggaa
ttggaagtgttacataaatgtaaatcaccttatatcgtggacttttatggtgcatttttc
atcgagggtgcagtatacatgtgtatggaatacatggatggtggttcattggataaaata
tatgatcaggaccctgaaattggcggtattgatgaaccacaattagcagttattgccaca
gcagtaattagaggtttgaaagtattaaaggatgttcatcacattatccatagagatgtg
aaacctacaaatatattatgttctgccaagcaaggtactataaaattatgtgattttgga
gtttcaggaaatttggtggcgtccatggcaaagaccaatattggatgtcaatcatatatg
gctccagaacgtattaagtcattaaatccagatattgctacatatacggttcaatctgat
atttggtccctaggattatccattttggaaatggcattgggcagatatccatacccacct
gaaacttttgataatattttctcacaattaagtgccattgtcgatggacctccaccaaaa
ttaccagcaggtaaatttagtaaagaagctcaagattttgtttccttatgtttacaaaag
gtccctgaaagaagattgaattatacagcattgttagaacatccttggttagttaaatat
agagacgttgatgtaggaatgagtgaatatctgacaacaagaaaggaattaaagaagaga
atattagcggagaagggtaatgataacttaccaaagaaggtccccgctctacacatgggt
gggttatga

DBGET integrated database retrieval system