KEGG   Naumovozyma castellii: NCAS_0A09770Help
Entry
NCAS_0A09770      CDS       T02233                                 

Gene name
NCAS0A09770
Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
ncs  Naumovozyma castellii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ncs00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ncs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1947718..1954359
Genome map
AA seq 2213 aa AA seqDB search
MSSVIPISPITPSMESTGDRLITLELKDGITLQGYSFGAEKSCAGELVFQTGMVGYPESI
TDPSYEGQILVITFPLVGNYGVPDFNLEDEFVKELPRYFESNRIHIAGLVIAHYTEKYSH
WLAKSSLGKWLQDEGIPAVYGVDTRALTKHLRDSGSMLGRLALQKTSSSSNNWPSSFDIP
EWVDPNVENLVATVSTKEPKLYLPPTDNENITIQKGPDGKTLRILAIDVGMKYNQIRCFI
KRGVELKVVPWDYDFTKEEYDGLFISNGPGDPSVLKELTQRLASVVDSKKTPIFGICLGH
QLLARSTGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDVDTLTSGWEPLFYNA
NDGSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFINSVKEFKSTGVLKSVEFPGGK
VEDNLRAHPRVEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATI
QTSKGLADKVYFLPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVL
GTQIDTIITTEDRELFANAIDEINEKCAKSHAANSVEEALTAVKDIGFPVIVRAAYALGG
LGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTVCNMENFD
PLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIE
VNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVINSVTKSTCACFEPSLDYCVVKMP
RWDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLEIDIDY
ELANPTDLRVFAIANAFSKLNYSIEKVWELTKIDKWFLSKLYDLIQFGKKVTAVGAIEGF
PSATLREAKQLGFDDRQIAKFLNSNEVAIRRLRKDHGITPFVKQIDTVAAEFPAHTNYLY
MTYNASSHDLSFDEHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANKIKTIMINYNPET
VSTDYDEADRLYFETINLERILDIYEIENSSGVVVSMGGQTSNNIAMSLHRENVKILGTS
PEMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAM
NTVYSKNDLASYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENA
GVHSGDATLIVPPQDLAKETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVIECNVR
ASRSFPFISKVVGVNLIELATKAVMGLPFEPYPVEKLPDDYVAVKVPQFSFPRLAGADPV
LGVEMASTGEVASFGHSKYEAYLKALKATGFKLPKKNILLSIGSYKEKKELLPCVQKLYN
MGFKLFATAGTADFISENGIPVQYLEVLNEDDEEKKEYSLTQHLANNEIDLYINLPSANR
YRRPASYVSNGYRTRRMAVDYSVPLVTNVKCAKLLIEALSRHIALDVSERDAQTSHRTVT
IPGLINVTGYVPNASNVIKGPAELKETTRLCLESGFTFSQIMPRSASGPTITDSHSLKAA
LSTAKDSSYTDFSLTVAGTSNNAEMIGSTSDQVSALFLPFHELKNKVSTVAELLKTWPIE
KQVIAEAKTADLASVLLLASLQNRSIHITGVSNKEDLALIMTVKEKDPSVTCDVCIHSLF
VTQEDYPEGVFLPTEEDQQFFWDNLDSIDAFSIGVLPTMLAHVTGNKVDIGSGIKDALPL
LLSAVEDGRLTIDDIVLRLHDNPIKIFNLPEQKAVVEIDLDYSFNNRKRWSPYTKGGLNG
GIERVLVNDETVVLSGDLIAIQPTGISVVKAQGSGPVSANIEAPLGTSTANKRKFSVFGE
RPSFANVDEAEKYMDQPIEQKLMSSRPPKELVVPGALENLIRGNNPFLGRNILSVKQFSR
SDLHVLFGVAEELRAAVAREGVLDLMKGHVMTTIFYEPSTRTCSSFIAAMERLGGRVVNI
NPSVSSVKKGETLQDTVRTLACYSDAIVMRHPDEMSVHIAAKYSPVPIINGGNGSREHPT
QAFLDLFTIREEIGTVNGITVTFLGDLKHGRTVHSLCRLLLHYQVRINLVSPTELRIPEG
LRKELKDAGLLGVESTELTPEIISKSDVLYCTRVQQERFKTQEDYEKFKNAYIIDNKVLA
HAKENMAVMHPLPRVNEIKEEVDYDHRAAYFREMKYGLFVRMALLAMVMGVDI
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgttattcctatctctccaattactccttccatggagtccaccggtgaccgt
ttaattactttagaactaaaagatggtatcactttacaaggttactcattcggtgctgag
aagagttgtgctggggaattggttttccaaactggtatggttggttatccagaatccatt
actgatccttcttatgaaggtcagatcttagttatcaccttcccattggtcggtaactac
ggtgttcctgatttcaatctagaagatgaatttgtgaaggaattaccaagatatttcgaa
agcaatagaatccatatcgcagggctagtcattgcccattatactgaaaaatactctcat
tggttagccaagtcttccttaggtaaatggttacaagatgaaggtattccagctgtatat
ggtgtggataccagagcattaactaaacatttgagagattcgggttctatgcttgggaga
ttagcattacaaaagacatcttcctcttctaataactggccatcaagtttcgatattcca
gaatgggttgatccaaacgttgaaaatttggttgccacagtttctactaaggaaccaaaa
ttatacctacctccaactgataatgaaaacataactatacaaaagggtccagatggtaaa
actttacgaattttagctattgatgttggtatgaaatataaccaaatccgttgcttcatt
aaacgtggtgttgaattgaaggtcgtcccatgggattacgatttcacaaaagaagaatat
gatggtctctttatttcaaatggtccaggtgatccatctgtcctcaaagaacttactcaa
agacttgcttctgttgttgattcaaaaaaaactccaatatttggtatttgtttgggtcat
caattgttagctagatcaactggtgcttccacattgaaactaaaatttggtaatcgtggt
cataacattccatgtacttctacaattagtggtcgttgttacattacatctcaaaatcat
ggttttgctgttgacgttgacacgttaacatctggctgggaaccattattttacaacgcc
aatgatggatcaaatgaaggtatttaccattcagaattgccatacttttcggtgcaattt
catcctgaatctactccaggtccaagagatactgaattcttatttgatgtcttcattaac
tctgtcaaggaattcaagtccactggtgtattaaaatctgtagaattcccaggtggaaag
gttgaagataatttgagggcacacccaagagttgaagcaaagaaggtcttggttttaggt
tcaggtgggttatccattggtcaagctggtgaattcgattattcagggtctcaggctatc
aaggcattgaaggaagaaggtatttatacgatactgattaatccaaatattgctactatt
caaacatctaaaggtttagctgacaaagtttatttcctacctgttacagcagaatttgtt
agaaaagttatccttcatgaacgtccagatgccatttatgttactttcggtggtcagaca
gccttgtcagttggtattgaaatgaaggatgaatttgaaagtttaggtgttaaagtccta
ggtactcaaattgatacaattatcacaaccgaagatcgtgaattattcgcaaacgccatt
gatgaaattaatgaaaaatgtgccaagtctcatgcagctaattctgtcgaagaagctttg
actgctgtgaaggacattggtttccctgtcattgttcgtgctgcatatgcccttggtggt
ctaggttctggtttcgccaacaatgaacaagaattgattgatctatgtaatgtcgcattc
gcatcctctccacaagtgttagtagaaagatcgatgaagggttggaaagaaattgaatat
gaagttgttcgtgatgcatttgataactgtgttacagtctgtaatatggaaaattttgat
ccattaggtattcataccggtgattctattgttgttgcaccatctcaaacattatctgat
gaagaatataacatgctaagaaatactgcagtcaacgtcattagacatttgggtgtcgtc
ggtgaatgtaatatacaatatgctttaaatccattttctaaagaatattgcattattgaa
gtcaatgctcgtttgtcccgttcttctgccctcgcatcaaaggctactggttatccttta
gcttatacagcagccaaattggggttgaatattccattaaatgaggttatcaactctgtt
acgaaatcgacttgtgcttgtttcgaaccttccttggattattgtgtcgttaaaatgcca
agatgggatttgaagaagtttacaagagtttcaacagaattatcctcttctatgaagtct
gttggtgaggttatgagtattggtagaacatttgaagaggctatccaaaaggccattaga
tctaccgaatatgcaaatctagggtttaatgaaacagatctagaaattgatattgattat
gaactagctaatccaaccgatttacgtgtctttgctattgccaacgcctttagtaagctg
aactattcaattgagaaggtttgggaacttacaaaaatcgataaatggttcctgtctaaa
ttgtatgatttgattcaattcggtaagaaggttaccgcggtcggtgccattgaaggtttc
ccatctgcaacgttaagggaagctaaacaactaggttttgatgatagacaaattgccaag
tttttaaattcaaatgaggtcgctattcgtcgtctgagaaaggatcatggtataacccca
tttgtaaaacagattgatactgtcgctgctgagtttccagctcatacaaactatttgtac
atgacttataatgcttcctctcacgatttatcatttgatgaacatggtgtcatggtcttg
ggttcaggtgtttaccgtattggttcttctgttgaatttgattggtgtgctgtcaccgca
gttagaacattgcgtgccaacaagattaaaactattatgatcaattacaacccagaaact
gtgtcaactgattacgatgaagctgacaggttatactttgaaacaattaatttagaaaga
attctagatatttatgagattgaaaactcttcaggtgttgttgtttccatgggtggtcaa
acctccaacaatattgccatgtccctacatcgtgagaatgttaaaattttaggtacttct
cccgaaatgattgactctgccgagaatcgttacaagttttcacgtatgttagaccaaatt
ggtgttgatcaacctgcttggaaagaattgacttctatggacgaagctgaatcatttgct
gaaaaggttggataccctgtgttggtccgtccatcttacgttctatctggtgctgctatg
aatactgtctattctaagaatgacctagcttcttacctaaatcaagctgttgaagtgtct
cgtgattatcctgtcgttataaccaaatacattgaaaatgcaaaggaaattgaaatggac
gctgtcgcaagaaatggtgagttagtaatgcatgtggtctctgaacatgttgaaaatgct
ggtgtccattcaggtgatgctactttaattgttcctcctcaagatttggccaaagagacc
gttgatagaattgttgttgccaccgccaagattggtaaagctttgaaaattactggtcca
tacaatattcaatttattgctaaagataatgagattaaggttattgaatgtaatgtccgt
gcctctcgttctttcccatttatttctaaggttgttggcgtcaatttaattgaactagcc
acaaaggctgtcatgggtcttccttttgaaccatatccagttgaaaaattacctgatgat
tatgtcgccgttaaggttccgcagttctcttttccacgtttagcaggcgctgatcctgtt
ttaggtgttgaaatggcttcgacaggtgaagttgcatcatttggtcattctaaatatgaa
gcatatctaaaggcgcttaaagcaactgggtttaaactcccaaagaaaaacattttacta
tccattggttcatataaagaaaaaaaagagttgttaccatgtgtccagaagttatacaat
atgggatttaagttatttgcaactgctggtacagctgatttcatctctgaaaacggaatt
cctgtccaatacttggaagttttgaatgaagatgatgaagagaagaaggaatattctttg
acacagcatctagctaacaacgaaattgacttatacattaatttaccttccgctaataga
taccgtcgtcctgcttcctatgtctcaaatgggtacagaacacgtagaatggctgttgat
tattctgttcctctagttacgaacgtcaagtgtgccaagttattaattgaggctctttca
agacacattgctctcgatgtttcggagcgtgatgctcaaacatcccacaggactgtgact
atcccaggtttgatcaacgttacaggttatgttccaaatgcttcaaatgtgattaaaggg
ccagctgaattgaaagagaccactcgtctgtgtttagaatctggtttcaccttttctcaa
attatgccaagatctgcaagtggcccaactatcactgattctcattctttgaaggcagct
ttatccacagctaaagactcatcatatactgatttctcattgactgtcgccggtacttcc
aataatgctgaaatgattggtagtacatctgaccaagtgagtgcattatttcttccattc
catgaattgaagaataaggtttctacagtcgctgagcttttaaagacctggccaatcgag
aagcaagttattgccgaagcaaagacagccgatttggcatccgttcttttactagcatcc
ctacaaaatagatcaatccatattactggagtttctaataaagaagatttagctttgatt
atgactgtgaaagaaaaagatccaagtgttacctgtgatgtttgtatccattctctgttt
gttactcaagaagactatccagaaggtgtattcctaccaaccgaggaggatcaacaattc
ttctgggataatttggattccattgatgcattttctataggtgttttaccaactatgctg
gctcacgttacaggaaacaaggttgatattggatctggtatcaaagatgccttaccactc
ctattatctgctgtagaggatggcagattgactattgacgatattgttctccgtttgcat
gacaaccctatcaagatatttaaccttccagaacaaaaggctgttgttgaaatcgattta
gattactcattcaataatagaaagagatggtctccatacactaagggtggcttaaatggt
ggtattgaacgtgttcttgtgaatgatgaaactgttgtactaagtggtgatttgatagct
atccaaccaactggtatttcggttgtaaaggctcaaggtagtggccccgtttctgccaat
attgaagctccattaggaacatctactgcaaataagagaaaattttctgtatttggagag
aggccatcgtttgctaatgttgatgaagctgaaaagtatatggatcaaccaattgagcaa
aaactaatgtcatcaagaccaccaaaagaattagttgtaccaggtgctttggaaaatttg
attcgtggaaataatccatttttaggaagaaatatcttatcagtgaaacaatttagtcgt
tctgatttacatgtgttattcggtgttgctgaagaacttagagctgctgttgccagagaa
ggtgttttagatctaatgaagggtcatgttatgaccacaattttctatgagccatctact
cgtacttgttcttcatttattgctgcaatggagcgcctagggggtagagtggtgaatatt
aacccatctgtttcttctgtaaaaaagggagaaactctacaagatactgttagaactttg
gcttgctacagtgatgcaattgttatgcgtcacccagatgaaatgtctgttcatattgca
gctaaatactcccctgtaccaatcattaacggtggtaatggttcacgtgaacatcctact
caggcattcctagatttgtttactattcgtgaagaaattggtactgttaatggtattacc
gttacattcttaggtgatttgaagcatggaagaacagttcattcgttgtgtcgtttgcta
ttacattaccaagtgagaattaaccttgtctccccaactgaattaagaataccagaaggc
ctaaggaaagaattaaaagatgcaggcttattgggtgtggaaagcactgaattgactcca
gagatcatctccaaatccgatgtgctatattgtacgagagttcaacaagaaagattcaag
acacaagaagattatgagaagttcaaaaatgcatacattattgacaataaggttttggcc
catgccaaggaaaatatggctgttatgcatccacttcctcgtgtcaatgaaattaaggaa
gaagttgattacgaccatcgtgcagcatactttagagaaatgaaatatggtttgtttgtc
agaatggctttattggccatggtcatgggtgttgatatttaa

DBGET integrated database retrieval system