KEGG   Naumovozyma castellii: NCAS_0A10140Help
Entry
NCAS_0A10140      CDS       T02233                                 

Gene name
NCAS0A10140
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ncs  Naumovozyma castellii
Brite
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCAS_0A10140 (NCAS0A10140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2024355..2024735
Genome map
AA seq 126 aa AA seqDB search
MSAVAEKKPASKAPAAKKTAPTTDGKKRTKARKETYSSYIYKVLKQTHPDTGISQKSMSI
LNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKY
SSSTQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgttgctgaaaagaaacctgcttccaaggccccagccgccaagaaaaccgcc
ccaaccaccgatggtaagaagagaactaaggccagaaaggaaacttactcctcttacatc
tacaaggttttgaagcaaacccatccagacaccggtatttctcaaaaatccatgtctatc
ttgaactccttcgttaacgatatctttgaaagaatcgctactgaagcttccaagttggcc
gcttacaacaagaagtctaccatctctgctagagaaattcaaactgctgtcagattgatc
ctaccaggtgaattggctaagcacgctgtctctgaaggtactagagctgtcaccaagtac
tcttcttccactcaagcttaa

DBGET integrated database retrieval system