KEGG   Naumovozyma castellii: NCAS_0A10580Help
Entry
NCAS_0A10580      CDS       T02233                                 

Gene name
NCAS0A10580
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ncs  Naumovozyma castellii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCAS_0A10580 (NCAS0A10580)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NCAS_0A10580 (NCAS0A10580)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCAS_0A10580 (NCAS0A10580)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCAS_0A10580 (NCAS0A10580)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     NCAS_0A10580 (NCAS0A10580)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2106352..2107923)
Genome map
AA seq 523 aa AA seqDB search
MVNLYKRDIQGQSLHLPSYNMIRRTTTNKLLLKNFKRSLMSSSIVMKEAAPVLFSMQDTA
RVVTLNRPAKLNALNFEMCQSMFQILNEYSKSDATNLIIVKSSDKGRSLCAGGDVATVAV
QNLNGNHKKAIEFFEAEYSLNLQMATYPKPIVTYMNGITMGGGVGLSVHTPFRIATENTK
WAMPEMDIGFFPDVGTTFALPRLVTMANNHSQMALYLCLTGEVLNGEDAYMLGLASHYVN
SENLQSLEVRLGELTPTKHITADPAKSSAIFFDMVNGTINEFSTNLPMDYKFKFTTDQLD
VIESCFDITRHTSIEEILRSLDQYAKSEAGISFCTEIKNKLATKSMTSMQIALKVLKENS
RDDINSALRRDLFTASNMCVNEEGVSEFSEATKHKLVDKQKTPYPWKHNSVISPNLLRAM
VSPKLSTPVSLWENFSNITWDQYPYHSKYQLPSEQSIKQYLRRVSGHQDGATSAFITKNE
VLKHFTRTNKLTKDKSDVALICNIICERKCNMDPVNGALIWND
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacctatataagagagacattcaggggcagtcattacaccttcccagttacaac
atgattagacgaacaaccactaacaaactcctgctcaagaattttaagagatccctaatg
agttcatctatagtcatgaaggaggcagctccagttctgtttagcatgcaagataccgct
cgtgtggtcacattaaacagacctgcaaaactcaatgcattaaacttcgaaatgtgtcaa
tccatgttccaaatccttaatgaatattccaagagtgatgctacaaatttaattattgta
aagtcttctgataaggggagatctctctgtgcaggcggtgatgttgcgactgtggcagtt
cagaacttgaatggtaatcacaagaaggcaattgagtttttcgaggcagaatattccctt
aatttgcagatggcaacataccctaaaccaattgtcacgtacatgaacgggattaccatg
ggtggtggtgtgggactctcagttcatacaccgttccgtatcgctactgaaaataccaaa
tgggcaatgccggaaatggatatcggattcttccctgacgttggtaccacttttgctctc
ccaagattggtcaccatggcaaataaccattctcaaatggccttatatttatgtttgact
ggtgaagttcttaatggggaggatgcatatatgttggggttggcgtctcattatgtgaat
tctgagaacctacaaagtttggaagttcgtttgggtgaacttactcctacgaaacatatt
actgctgatcctgcaaagtctagcgccatctttttcgatatggttaatggtacgataaat
gaattcagcacaaatttacccatggattataaattcaagtttacaactgatcaattagat
gtgattgaatcctgttttgatattactagacatacttcaattgaagaaatcttaagaagt
ttggatcagtatgcgaagagcgaagctggtataagtttttgcacagagatcaagaataaa
ctagccaccaaatcaatgacatctatgcaaattgcccttaaagttctaaaagagaattca
agagacgatataaattcagcactgagaagagatttattcacagcctcaaatatgtgtgtt
aacgaagaaggagtctcagaattttcagaagctacaaaacataaacttgttgacaaacaa
aaaactccttatccctggaaacacaatagtgtcatttcaccaaatttattaagggcaatg
gttagtcctaaactttccacacctgtgtctctttgggagaatttctctaacataacttgg
gatcagtacccctatcattcgaagtatcagctcccctctgagcaatctattaagcaatat
ttgaggagagttagtggccatcaggatggtgccacttccgcttttattactaagaatgaa
gtcctaaaacatttcacgagaacgaataagttgactaaggataaaagtgacgttgcccta
atttgcaacataatatgtgagaggaaatgcaatatggatcctgtaaatggagccttgata
tggaacgattag

DBGET integrated database retrieval system