KEGG   Naumovozyma castellii: NCAS_0A11020Help
Entry
NCAS_0A11020      CDS       T02233                                 

Gene name
NCAS0A11020
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCAS_0A11020 (NCAS0A11020)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NCAS_0A11020 (NCAS0A11020)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2193556..2194869
Genome map
AA seq 437 aa AA seqDB search
MNNHLALNNNDSLQNWQGDPTQFYKQKFNPPIYPPPPPSRSSSSSISRKRAKLGFHKQPV
VPQRTVCSSTKFSIRGRYKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIKKVTNIFQKEI
LLKRAIRELKFMNFFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHSSIKL
TEFHIQYFMYQILSGLKYIHSADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYND
NGNLASPKLHDITNYVATRWYRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHD
TLHQVYEIVKILGPPSQRLLSQFASVKAYNIFNNNLAKLHWNSPIDWKTLYPEASNSSIH
LLQNLLKWNPRERFDVEQAITHPFLNEVRTPMDEPVHMLGPFDFSYEFKLNSMEILRSYL
KEEVKKFRQNRNYIYND
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccatcttgctctcaacaacaacgactccctgcagaactggcagggagacccc
acccagttctataaacaaaaatttaacccgcccatatatccaccaccaccgccctccaga
tcatcctcatcctccatctccaggaagagagcaaaattggggttccacaaacaacccgtc
gtcccccaaagaacagtctgctctagtacaaaattctccataaggggccgctacaagatt
atcaaagtcctagggaagggttcctatggtgtggtatgttccgccatggataataaaaac
ccagcaaatgcataccctgtggccatcaagaaagttaccaatatcttccagaaggagatc
ttgctaaagagagctattagggaattgaaatttatgaacttcttccaaggacataagaat
atcgttaatttgatagatttggaaatcataaatgaaaactcaccatacgatggattgtat
tgttaccaagagttgatcgattacgatttggccaaggttattcattcctccatcaaattg
acagagttccatatccaatacttcatgtaccaaattttatcaggtttgaaatatattcat
tccgctgatgtcattcatagagatttgaaaccggggaatatattgtgtacgttgaatggg
aatttgaaaatttgcgattttggcttggcaagaggtattaaccccaaattttataatgat
aatggtaacttggcaagtcctaaattacacgatattacaaattacgtggcgacaagatgg
tatagggccccggaattgatattatctcataagatgtatacaaaggcaatagacctgtgg
tcagtggggtgtatcctggctgaattttacggaaggagacctatatttatgggtcatgac
acgttacaccaagtttatgaaattgtgaaaatattgggtccaccatcacaacgattattg
tctcaattcgcctccgtgaaagcttacaatatattcaataataatttagccaaattacat
tggaattcaccaattgattggaaaacattatatccagaagcatctaattcatccattcac
ttattacaaaatttattgaaatggaatcccagggaaagatttgatgtggagcaagcaatt
acacacccattcttaaatgaggtaagaactcccatggatgaaccagttcatatgctagga
ccttttgatttttcttacgaatttaaattgaattcaatggaaatattgagatcatactta
aaggaggaagtgaagaagtttagacagaatagaaattacatttataatgactaa

DBGET integrated database retrieval system