KEGG   Naumovozyma castellii: NCAS_0A11180Help
Entry
NCAS_0A11180      CDS       T02233                                 

Gene name
NCAS0A11180
Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCAS_0A11180 (NCAS0A11180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2216701..2218173)
Genome map
AA seq 490 aa AA seqDB search
MTRLVISTSTFQSQVADLLPCNKYKKSQLTHSLIESTGLLNSFDHVISDFICSKDDLLQF
HSKDYIELLMDNKYNTVLPYDVEESSWNELNEISTSWHESKNEAEFKRFTSREKLYEHFK
QLSPKEKPINGKRSAWDALLDSDPDEEVQQNETLEGNAEIKATLMKEHNLEGDCPLFSYI
PMYTQVVTGATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRK
NGFKNISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPGFFPCTGSLQEAKAGSSIVNI
PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGAIM
KLINTFPSCSVVLLGGGGYNEKVMSRFYNYLTWNIAFEYSKRPPSGLFLSSELNLLIPDH
EFIDVYQDEQYKYWIYEQEGSSKYKTLRNDNKVDFVAELRAYYGHGLQPQLPHDVSEDNS
PGTVHMMVPK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactagattggtgatatccacatctacgttccaatctcaggtagcggaccttcttccg
tgtaacaaatataagaaatcacaattgacacattcattgattgaaagtactggtttactg
aactcatttgaccacgtcatatctgatttcatttgttcgaaggatgatttattacaattt
cactccaaggattacattgagctattaatggacaataaatataacacagttttaccatac
gatgtggaagaaagttcatggaatgaattaaatgaaatctccaccagttggcacgaatct
aagaatgaagctgaattcaaacggtttacttctcgagagaaactttatgaacattttaaa
cagctctctccaaaggaaaaacccatcaatggaaaacgttcagcttgggatgcattatta
gattcagatccagatgaagaggtccaacagaatgaaactctcgaaggtaatgctgaaata
aaggctactcttatgaaggagcataacctagaaggtgactgccccctcttttcttatatt
ccaatgtacacacaggtggtaactggtgccacattgtccttgtcaaaatttctccaaccg
aatagcgaacgaagcattgcgatcaattgggatggtggaagacaccatgcatttaaaaat
aaggcaagtgggttttgttacgttaatgatattgttttattgattcaaaaaataagaaaa
aatggattcaaaaacatttcttatgtggattttgatctgcatcatggtgatggtgttcag
aaagcctttcagttctccaaaaatgtacagaccgtgtcattgcatatgtttgaacctggt
ttctttccctgtacaggttcattacaagaagcaaaagctggaagttctattgtaaatatc
ccactattacatggactggatggaacatttctcaaacaattaacaaaggacataattatt
ccagttgtagaacaacatgagcctgaagttctagtgattcagtgtggtggtgatggttta
attggtgatcaatataacgaatggcaactgacaattcatgatttatcaggtgctatcatg
aaattgattaacacttttccttcttgttctgttgtattattgggtggtggtggctataat
gaaaaagtgatgagtagattttataattacttgacctggaatattgcattcgagtacagt
aagcgcccaccgagtggcttgtttctttcgtctgagcttaatttgctcataccagatcat
gaatttatcgatgtttaccaagatgaacagtataaatattggatatatgagcaagaagga
agctcaaaatataagactttaagaaacgataacaaagtagatttcgtagccgaattacgt
gcttactatggtcatggtttgcagcctcaattgccccatgacgtaagcgaagataactca
cctggaacagtacatatgatggtccccaaatga

DBGET integrated database retrieval system