KEGG   Naumovozyma castellii: NCAS_0A12570Help
Entry
NCAS_0A12570      CDS       T02233                                 

Gene name
NCAS0A12570
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ncs  Naumovozyma castellii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCAS_0A12570 (NCAS0A12570)
   00052 Galactose metabolism
    NCAS_0A12570 (NCAS0A12570)
   00500 Starch and sucrose metabolism
    NCAS_0A12570 (NCAS0A12570)
   00520 Amino sugar and nucleotide sugar metabolism
    NCAS_0A12570 (NCAS0A12570)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCAS_0A12570 (NCAS0A12570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2479404..2480912)
Genome map
AA seq 502 aa AA seqDB search
MSGTINKKHIKTQSTYAFESNTSNVAASQMRNALNKLADSVQGDEEERARFEAQLDSFFS
LFRRYLVEKSSGNTLDWEKIKSPNPDEVVAYETIAQQPENVTNLSKLAVLKLNGGLGTSM
GCVGPKSVIEVRDGNTFLDLSVRQIEHLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSAN
RIRIRSFNQSKFPRVYKDSMLPVPTDYEDKLDAWYPPGHGDLFEALHASGELDALIAQGR
EILFVSNGDNLGATVDLKILDHMLQTGSEYIMELTDKTRADVKGGTLINYDGQVRLLEVA
QVPKEHIDEFKNIRKFKNFNTNNLWINLKAIKRLIESSSLEVEIIPNKKTIVRGGHEVNV
LQLETACGAAIRHFNGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLQHGALKLDPERFGP
NPLIKLGSHFKKVSDFSSRISHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSEGQKI
DIPNGSVLENVVITGNLQILEH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaacaataaacaagaaacatatcaagacgcaatctacttacgcattcgaaagc
aacacaagcaacgttgctgcatcccaaatgagaaacgctttgaacaaattggctgactcc
gttcaaggtgatgaagaggaacgtgccagatttgaagctcaattggactctttcttctct
ctatttagaagatacttggtcgaaaaatcttcaggtaacactttggattgggaaaagatc
aaatctccaaatcctgatgaagtggtcgcttacgaaactatcgctcaacaaccggaaaat
gtcaccaatttatcgaaattggcggtcttgaaattaaatggtgggttgggtacctcaatg
gggtgtgttggtccaaaatctgtcattgaagtgagagatgggaacacatttttggattta
tctgttcgtcaaattgagcatttaaatagacaatatgatagtgatgtcccattattatta
atgaattcattcaatacggataaggatacagaacatttaatcaagaaatactctgctaat
agaattagaattagatcctttaaccaatctaaattcccaagagtttacaaggattccatg
ttacctgtcccaactgattatgaggataaattggatgcctggtatccaccgggacatggt
gatttattcgaagccttacatgcttctggtgaattggatgcattgattgctcaaggtaga
gagatccttttcgtttccaatggtgataatttaggtgctaccgtggatttgaaaatctta
gatcatatgctacaaactggttccgaatatattatggaattgactgataagacaagagct
gacgtgaaaggtggtactttaattaactatgatggtcaagttagattactagaagtcgct
caagtaccaaaggaacatatcgatgaatttaaaaatattagaaaattcaagaattttaac
acaaataatttatggattaatttgaaagccattaagagattaattgaatcaagttcattg
gaagtggaaattattccaaataagaaaactatcgttagaggtggtcacgaagttaatgtg
ttacaattggaaactgcatgtggtgccgccattagacatttcaatggtgctcatggtgtt
gttgtaccaagatcaagattcttacctgttaagacatgttccgatttattattggttaaa
tctgatcttttctatttacaacatggtgctttgaaattagatccagaaagatttggtcca
aatccattaattaaattgggttcccatttcaaaaaagtttcagatttcagttctagaatc
tctcacatccctaagattgtagaattggatcatttaaccatcactggtaatgtcttttta
ggtaaagatgttactttgagaggtactgtcatcattgtctgttcagaaggtcaaaagata
gatattccaaatggttctgtcttggaaaatgttgtcattactggtaacttgcaaatctta
gaacattga

DBGET integrated database retrieval system