KEGG   Naumovozyma castellii: NCAS_0A13000Help
Entry
NCAS_0A13000      CDS       T02233                                 

Gene name
NCAS0A13000
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ncs  Naumovozyma castellii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCAS_0A13000 (NCAS0A13000)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2559364..2559693
Genome map
AA seq 109 aa AA seqDB search
MGEYKPGNEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIFGRNSGQAPGYSYTDANIK
KNVKWDEQKMSDYLTNPKKYIPGTKMAFGGLKKEKDRNDLIAYMKKACE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaatataaaccaggtaacgaaaagaaaggtgctaccttattcaagactagatgt
ctacaatgtcacactgttgaagaaggtggtccacataaagttggtccaaatttgcacggc
atctttggtcgtaattctgggcaagctccaggttattcttacactgatgctaatattaag
aagaatgttaaatgggatgagcaaaagatgtctgattatttgaccaatccaaagaaatat
ataccaggtaccaagatggcattcggtgggttgaagaaggagaaggatagaaatgatttg
attgcttacatgaagaaagcctgtgagtaa

DBGET integrated database retrieval system