KEGG   Naumovozyma castellii: NCAS_0A13140Help
Entry
NCAS_0A13140      CDS       T02233                                 

Gene name
NCAS0A13140
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ncs  Naumovozyma castellii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCAS_0A13140 (NCAS0A13140)
Enzymes [BR:ncs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCAS_0A13140 (NCAS0A13140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2582432..2584477)
Genome map
AA seq 681 aa AA seqDB search
MLLRIQNIMWLLLSICYTVGGKASDSPPGFPAPLTLVNFASELKQGLHLVEFYSPYCSHC
NSLAPIWEKTWESFHEEGEKLNITMSQVNCIESGDICAKENIEFYPNLRLYGPNGFIKNF
SGKRKAEAFIEFMKTEAADPSNTEVIDSQSVALTGHHFAKLLAGASPTRYLVSFWPSEDI
SHVDEKIQFKNCRECSTFSKAWGKLSEKLKEFNIATGHLNCQSNELICKELGFANLLEAG
NDGANREPRIALLVPNKTTNNFFVYENPLTTDIAVYEEFAKRLYSNNEVPELTEIQIMDI
INKNFAPLEEQKLHLVFNYDVKTVFPEDFDILEYLIEPLSKIPNMYLYKSVGDLRKVTHS
AFEEMYGLINYNETEAEKSLNEDAFALNTITQTPTFYLFKDGDKIPHVFPGYSTTEMRNL
DAIMQWVNEYATPLITQVTESNFEDLLGSTPSRYSNVIIVLTDSSRPKEQIQNIKDLFIG
YYDYEHIRQQNMFQLILDERNDKERRVAELKSQKAQAERILNTLRKEIPHTDDKAVILTY
VDIAKQKDLLSNIGINSHLEHKAGDVIMIDRKTGFFYELNTFGSTLTSSPYEIKDTLRSL
NFPGPSIFKYVKHGKLINSPYNGYFEHLNVVHRHGIWGYIVVGIIMFSLFKLRRAMTAHK
IKERYNSQGLLGVYHQKKPLD
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaagaatacagaatataatgtggttactcctatcgatatgctacacggtagga
ggcaaagcatcagattcacctccagggttcccagccccgctaacactagttaacttcgca
tcggaacttaagcaaggactccatttagttgaattttatagtccctactgttcacattgt
aattctttggctccaatatgggagaagacttgggaatcattccatgaagaaggtgaaaag
ctaaatattacgatgtcccaagtgaattgcattgaaagtggtgatatatgtgctaaagag
aatattgaattctatccgaacttacgattatacggcccaaatggatttattaagaatttc
tctgggaagaggaaagctgaagcattcattgaatttatgaagacggaggctgctgatccc
tcgaatactgaggtgattgacagtcaaagtgtggcactcacagggcatcattttgcaaaa
ctattggcaggagcctctccaactcgctatttggtttccttttggccttccgaagatatt
tcacatgttgatgagaagattcaatttaaaaactgcagagaatgttcaactttttccaag
gcatgggggaaattatctgaaaaattaaaggagttcaatattgccaccggtcatctaaat
tgccaatctaatgaattgatttgtaaagagctcggttttgctaatttgctagaagcagga
aacgatggggctaatagagagcctagaattgcattacttgttcctaataaaactacaaat
aacttctttgtgtatgaaaacccgcttactacagatattgccgtctatgaagaatttgcc
aaacggttatattcgaataatgaagtccctgaattaacagaaattcaaattatggacata
ataaataaaaattttgctcctttagaagagcaaaaactccatctggtatttaattatgat
gtaaagactgtttttccagaagactttgatattttggaatacttaattgagcccttatca
aagattccaaacatgtatctttataaatcagttggtgatttaagaaaggtaacgcactcc
gcttttgaagaaatgtatggccttattaattataacgaaacagaagcagaaaaatcctta
aatgaagatgcatttgctttaaacacaataactcaaactccgaccttttatttgtttaaa
gatggtgacaagatcccccatgtttttccaggctattctacaactgaaatgagaaacttg
gatgcaataatgcaatgggttaatgaatatgctacacctttgattacccaggttacagaa
tcgaactttgaggaccttttaggatcaactccatctcgctatagtaatgtaataatagta
ttgacagattcatcacgaccaaaggaacaaattcaaaatattaaagatctattcattgga
tattatgattacgaacatattcgccaacaaaacatgttccaattgattttggatgagaga
aatgataaagaaagaagagtagctgaattgaaatctcagaaggcccaagcagaacgaatt
ctaaacactttacgtaaggaaatcccacatactgacgataaggcggttattttaacgtac
gtcgacattgccaagcaaaaagatctgttatcaaacattggtataaattcgcatcttgaa
cataaagccggtgatgttattatgattgatagaaaaacaggttttttctatgaattgaat
acattcggctctactttaaccagctcgccctatgaaattaaagatacgttacgttcatta
aatttcccaggtccaagcattttcaagtacgttaaacatgggaaattgataaactcccca
tataatggttattttgaacaccttaacgttgttcataggcatggtatttggggttacatt
gttgtcggtattattatgttttctttgttcaaactgagaagagcaatgacagcacataaa
ataaaggaaagatataattcccaaggtctattaggagtatatcatcaaaagaaaccctta
gattga

DBGET integrated database retrieval system