KEGG   Naumovozyma castellii: NCAS_0A14050Help
Entry
NCAS_0A14050      CDS       T02233                                 

Gene name
NCAS0A14050
Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ncs  Naumovozyma castellii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCAS_0A14050 (NCAS0A14050)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NCAS_0A14050 (NCAS0A14050)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NCAS_0A14050 (NCAS0A14050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2763082..2764551)
Genome map
AA seq 489 aa AA seqDB search
MNSLQDPFHRKTFQRKNLKNLSLQDSTTSQIPASAPINHMPFSNIPSSKPNINQPMGPPS
TSDNTSAYFNQKRGNIFARRGLKKNLTLHVSNAPTPIKTQQELPSLPTNDTIIIQSQSQQ
QHQQQISPSSSSSPNEPPSPAAKDIPTKDSIYQLQDLVRLGKIGAGNSGTVIKALHVPSS
KIIAQKIIPLEKNNEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNNEIVILMEYM
DCGSLDRIFSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNYLYENYKIIHRDI
KPSNVLINSKGLVKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSTKGDVWSLGL
MIIELVTGQFPLGVGETPEGILDLLQRIVNEPSPQLPKTDKFSVEMTDFVNRCCVKDEKD
RSSIHELLVHDFILMYKDPLYNREFRHWCKMIKSYIKQDKQIKREDNERAKLEKRQLDKA
SEAARDNRR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcttcaagatcccttccaccgtaaaacttttcaacgaaaaaacctgaagaat
ttatcgctgcaggatagcacaacctcacaaatacccgcttcagccccaataaaccatatg
cccttctcgaacatcccctcatctaagccaaacataaaccaaccgatgggacctccctcc
acatcagataatactagcgcttactttaatcaaaagagaggtaacatttttgcaagaaga
ggcttaaaaaagaatctgacgttgcatgtctcaaatgccccaactcccataaaaacacag
caggaactgccatcccttccaacaaatgacactataataatacaatcacaatcgcagcaa
caacatcaacaacagatatctccgtcgtcatcatcatcgcctaacgaacctccttcgccc
gcagcaaaggatataccaacaaaggactccatataccaacttcaggatttggtccgtctg
gggaagattggtgcagggaattcaggaactgtaataaaggcccttcacgtccccagctca
aagataatagcacaaaagattataccgcttgagaaaaacaacgaaatcgtagttaaccaa
ctaattagagaactcacaataatgaaaagtattaaaccacataagaatatcatttctttt
tatgcagcattctatactcatcatcaaaataatgagatcgtcatattgatggagtatatg
gactgtgggtctcttgataggatattctccacttataagcggttcgtcgctaggggtgtc
ttagaccctcgtgagaagaattggtttaacgattccttgatactgtcaaggatctcgtat
gccgttttgaatgggttgaattatttgtatgaaaattataagatcattcatagagatatt
aaaccttccaatgtattgattaattctaaagggttagttaaattgtgcgattttggtgtc
tctaagaaattaattaattcaatagcagatacctttgtgggaacatccacttacatgtca
ccagagagaatacaggggaacgtctattccactaagggtgatgtctggtctcttggatta
atgatcattgaactagtgacgggacaattcccattgggggttggagagactccagaggga
atactggatcttttacaaaggattgtcaatgagccatctccccagttaccaaagactgac
aaattctccgtagaaatgactgatttcgttaataggtgttgtgtcaaggatgaaaaggat
agatcttccattcatgaattgttagtccatgatttcatattgatgtataaagatccctta
tacaatagggaatttcgacattggtgtaaaatgatcaagtcatatataaaacaggataaa
cagattaagagagaggacaacgagagggctaaactagagaaaagacagttggataaggcc
tctgaagccgccagagataatagacgataa

DBGET integrated database retrieval system