KEGG   Naumovozyma castellii: NCAS_0A14470Help
Entry
NCAS_0A14470      CDS       T02233                                 

Gene name
NCAS0A14470
Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
ncs  Naumovozyma castellii
Pathway
ncs03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCAS_0A14470 (NCAS0A14470)
Messenger RNA biogenesis [BR:ncs03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     NCAS_0A14470 (NCAS0A14470)
Chromosome and associated proteins [BR:ncs03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    NCAS_0A14470 (NCAS0A14470)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 WD40_like
Motif
Other DBs
NCBI-GeneID: 11529326
NCBI-ProteinID: XP_003674384
UniProt: G0V955
Position
1:complement(2848835..2849923)
Genome map
AA seq 362 aa AA seqDB search
MAFFSTSNSNQGTSSTAATEADLANDIVLNNPAEDSISDIAFSPQQDFIFSVSSWDGKVR
IWDVQGGVAQGRSQYEHAGPVLSTRWSNDGSKVASGGCDNIVKLFDVASGQSQQIGMHDA
PVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQAISTVIMPDRVYTMDSKQQLLVVG
TAERHIAIINLNNPGSIFKTTLSPLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQ
KKSGFSFKCHRQNNPNRTAGSQQSLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHR
LKAFPSLRSSIPVVNFNRNGSVFAYALSYDWHEGHMGNRPDYANVIRLHPTRDDEVKEKK
KR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcttttttttctacatcaaatagtaaccaaggtacatcttcgacagcagctacggaa
gctgatttagccaatgatattgtgcttaacaatccagcagaagattccatttcagatata
gcattcagtccccaacaagattttatattcagtgtgagttcatgggatgggaaagtccga
atctgggatgttcaaggaggtgtagctcaaggcagaagtcaatatgagcatgcaggtcca
gtattatcaactagatggtctaacgatggttctaaagtggcatctgggggctgtgataat
attgtaaaactattcgatgtcgccagtggacaatcacaacaaattggtatgcacgatgcc
cctgtaaaggctgtaagatttgtcaattgtggtccgtcaaacaccgaatgtttagtgaca
ggttcttgggataaatccatcaaatactgggatatgagacaacctcaggctatttctact
gtcatcatgccagatcgtgtatatacaatggacagtaaacaacagttacttgttgtggga
actgcggaaagacacattgcaataataaatcttaacaatccaggttccatatttaaaacc
acactctctccattaaagtggcaaacaagagttgtttcatgctataatgaaggtgatgga
tatgccattggttcaatagaaggaagatgtgctataaggtatgtagatgatgaaatgcaa
aagaaatctggattttcattcaaatgtcatcgtcagaataatcccaacagaacagcaggc
tcacaacaatctttggtctaccctgtaaacagtattgcctttcatcctatttatgggacc
ttcgctacagcaggtggggacgggtgtttccatttttgggataagaaccatagacataga
ttgaaggcatttccttcactacgatcctcaataccggtggtaaattttaatagaaatggt
tccgtgtttgcatatgcattgagttatgattggcacgaaggacacatgggaaacagacca
gactacgccaacgttataagactacatcccaccagagatgatgaggtaaaagaaaagaag
aaaagatag

DBGET integrated database retrieval system