KEGG   Naumovozyma castellii: NCAS_0A14470Help
Entry
NCAS_0A14470      CDS       T02233                                 

Gene name
NCAS0A14470
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ncs  Naumovozyma castellii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ncs03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2848835..2849923)
Genome map
AA seq 362 aa AA seqDB search
MAFFSTSNSNQGTSSTAATEADLANDIVLNNPAEDSISDIAFSPQQDFIFSVSSWDGKVR
IWDVQGGVAQGRSQYEHAGPVLSTRWSNDGSKVASGGCDNIVKLFDVASGQSQQIGMHDA
PVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQAISTVIMPDRVYTMDSKQQLLVVG
TAERHIAIINLNNPGSIFKTTLSPLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQ
KKSGFSFKCHRQNNPNRTAGSQQSLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHR
LKAFPSLRSSIPVVNFNRNGSVFAYALSYDWHEGHMGNRPDYANVIRLHPTRDDEVKEKK
KR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcttttttttctacatcaaatagtaaccaaggtacatcttcgacagcagctacggaa
gctgatttagccaatgatattgtgcttaacaatccagcagaagattccatttcagatata
gcattcagtccccaacaagattttatattcagtgtgagttcatgggatgggaaagtccga
atctgggatgttcaaggaggtgtagctcaaggcagaagtcaatatgagcatgcaggtcca
gtattatcaactagatggtctaacgatggttctaaagtggcatctgggggctgtgataat
attgtaaaactattcgatgtcgccagtggacaatcacaacaaattggtatgcacgatgcc
cctgtaaaggctgtaagatttgtcaattgtggtccgtcaaacaccgaatgtttagtgaca
ggttcttgggataaatccatcaaatactgggatatgagacaacctcaggctatttctact
gtcatcatgccagatcgtgtatatacaatggacagtaaacaacagttacttgttgtggga
actgcggaaagacacattgcaataataaatcttaacaatccaggttccatatttaaaacc
acactctctccattaaagtggcaaacaagagttgtttcatgctataatgaaggtgatgga
tatgccattggttcaatagaaggaagatgtgctataaggtatgtagatgatgaaatgcaa
aagaaatctggattttcattcaaatgtcatcgtcagaataatcccaacagaacagcaggc
tcacaacaatctttggtctaccctgtaaacagtattgcctttcatcctatttatgggacc
ttcgctacagcaggtggggacgggtgtttccatttttgggataagaaccatagacataga
ttgaaggcatttccttcactacgatcctcaataccggtggtaaattttaatagaaatggt
tccgtgtttgcatatgcattgagttatgattggcacgaaggacacatgggaaacagacca
gactacgccaacgttataagactacatcccaccagagatgatgaggtaaaagaaaagaag
aaaagatag

DBGET integrated database retrieval system