KEGG   Naumovozyma castellii: NCAS_0A15250Help
Entry
NCAS_0A15250      CDS       T02233                                 

Gene name
NCAS0A15250
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ncs  Naumovozyma castellii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0A15250 (NCAS0A15250)
Enzymes [BR:ncs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NCAS_0A15250 (NCAS0A15250)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     NCAS_0A15250 (NCAS0A15250)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2996060..3000625
Genome map
AA seq 1521 aa AA seqDB search
MSLKRSLLLRLTDTGEPITSCSYGPGVLTLPSLPLSELDEEGTPLYTVKLLIAAGSPVAR
DGLVWTNCPPNKETPFKRDKFYKKIIKSSFHHDDTIDLDVFNPGSYCFYLSFRNSEEQLE
TTRKFYFLALPNLTLNGKTLQLNSIAMQSVVSKWMGKDWDKVFKKIADKEYNMIHFTPLQ
VRGESNSPYSLADHLAFDPEFFSSPEDVKKMIQHIHKDYNMLSMTDMVFNHTANNSAWLL
DHPEAGYNQYTAPHLRAAIELDETLLKFSDNLKNWGCPTDLKTVDDLFKVMDGIKIHVLG
VLKLWEYYVVNVDDALKEIEDNWDKAALWDGPSLDDVKDDLNKIANFVRAHATRENFGVL
AGRKSNQVDPKKFNEILKTLYGNDLNENTLEKAHQILDSINLPLYKEYDDDVNEILEQLF
NRIKYLRIEEDGPKQGPITKEKPLSEPYFTRFTGKDGKKYALANNGWIWNGNPLVDFASS
KSKTYLRREVIVWGDCVKLRYGKGPEDSPYLWKRMAEYVEMNAAIFDGFRIDNCHSTPLH
VGEYYLDLARKVNPNLYVVAELFTGSEATDCLFVERLGVSSLIREAMQAWSEEELSRLVH
KHGGRPIGSYKFVPMDDFPFPADIPLDEEYCMINPEDNALRCVSEIMIPKILTATPPHAL
FMDCTHDNETPFQKRTVEDTLPNAALVSLCSSAIGSVYGYDEIFPYLLELVTETRTYDTK
ECNGIGKVKSLLNEIREDIGSKTKDIEDCEMHVHHEGQYITFHRTDVKSGAGYYLIARTK
FYDAGEQKLPPVILNDSQCKLKFAYSLEKVGDVPNSKEFIKGIPTKLRELTDFEVKYDKN
SRSSTIIVPEDFPQGSIAVFETQQNGVDTWLDHFLRSGALSATRNVTLESLNCILYRAES
EELESSAGKNGAYDIPDFGKLVYCGLQGWITILQDIVFNNDLAHPLSANLRNGHWALDYT
VDRLDLYKDQPGVEDIQEWLRSRFDKIKKLPYYLTPSYFALIIGVLYGCCRLRAMQLMSE
NIGKSTVFVQSLAMTSIQMVSKMKSTSILPFENVPAMAAGLPHFSTDYMRCWGRDVFISL
RGLLLTTGRFDQAKSHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFTQSIQDYATI
VPNGTDILKEEITRRFPKDDTYVALDDSRAFSETSSLEDILYEILSRHARGIKYREANAG
PNLDRVMTDKGFDVEVHVDWSTGLIHGGSPYNCGTWMDKMGESEKAHSVGVPGTPRDGAA
VEINGLLKSCLRFVIDLNKQGKFKYTDVVKQDGEKISLEAWNDLLQENFEKKFYVPKDPA
QDKFYDILPNVVNRRGIYKDLYKSSKPYEDYQLRPNFAIAMTVAPELFTPEYATFAINIA
DTVLKGPVGMRTLDPSDYNYRPYYINSEDSEDFATSKGRNYHQGPEWVWCYGYFLRAFHY
FNFHTNIRCQNEPKDKPSSYLYQQLYNRLAGHREWLKNSEWRGLTELTNKDGEICNDSSP
TQAWSSGCLLDVFYDLWSAYE
NT seq 4566 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaaaaagatctttacttttaaggcttacagacacaggtgaaccgattacaagt
tgctcttatgggcccggtgttcttactctaccctcattgcccctttcagaacttgatgaa
gaaggtactcccttatatacagtcaaattattaattgctgctgggtctcctgtggcaaga
gatggtttagtctggacaaattgtcctcctaataaggaaactccattcaagagagataaa
ttctataagaaaattattaagtcaagcttccatcatgatgataccattgatttggatgtc
ttcaatccaggttcatattgtttctatctttcctttagaaattctgaagaacaattggaa
actacaagaaaattttatttcttggcattacctaacttgactctaaatgggaaaacttta
caattgaattcaatcgctatgcaaagtgtagtttctaaatggatgggtaaagactgggac
aaggtctttaaaaagattgcagacaaggaatacaatatgattcattttacacccttacaa
gtaagaggtgaatctaattctccttattccttggctgatcatttagcatttgatcctgaa
ttcttcagctctcccgaagatgtcaagaaaatgatacaacacatacataaggattataat
atgttgtccatgactgatatggtctttaaccatactgccaataattctgcatggttgttg
gatcatccagaagcaggttacaatcaatatactgcacctcatttgagagctgccattgaa
ttagatgaaactcttttgaaatttagtgacaatctgaagaattggggttgtccaactgat
ttaaaaacagtggatgatttattcaaggtgatggatgggattaaaattcacgttcttggt
gtattaaaattatgggaatactatgttgttaatgtcgatgatgctcttaaggaaattgaa
gacaattgggacaaagcagctctttgggatggtccttccttagatgatgtgaaagatgat
ctgaataaaatcgctaactttgttcgtgctcatgcaacaagagaaaattttggtgttttg
gcagggagaaaatcaaatcaagtggatcccaagaaatttaatgagatattgaaaactcta
tatggtaatgaccttaatgaaaacactttggaaaaggctcaccaaattttggattctata
aacttaccgttatacaaggaatacgacgatgatgtcaatgagattttagaacaactattt
aatcgtattaaatatttgagaattgaagaggatggtccaaaacaaggtcctattacaaaa
gaaaaaccactaagtgagccttactttacccgttttacgggcaaagatggtaagaagtat
gcattagcaaataatggttggatttggaatggcaacccattagtagattttgcgtcatcc
aagtctaaaacgtacctacgtagagaagtcattgtttggggtgactgtgtcaaattaaga
tatggtaaaggaccagaagattctccatatttatggaagagaatggctgaatatgtggaa
atgaatgcagcaatctttgatggttttagaatagacaattgtcattcaactcctcttcat
gtgggtgaatattatttagacttagcaagaaaggtcaatccaaatctttatgttgtcgct
gaattattcactggttcagaagctacagattgtttatttgttgaaagattgggtgtctct
tctttaatcagagaagcaatgcaggcttggtcagaggaagaattatccagattagtacac
aagcatggtggaagaccaatcggttcatacaagtttgtacctatggatgatttcccattc
cctgctgatataccattagatgaagaatactgtatgattaatccagaggataatgccctt
agatgcgtttcagaaattatgataccaaaaattttaactgcaacacctcctcatgctttg
tttatggattgtactcatgataatgaaactcctttccaaaagagaaccgtagaggatacg
ttaccaaatgcagcacttgtttctttatgctcctctgctattggatcagtatatggttat
gatgagattttcccatatctactagaactagtcacagaaaccagaacttatgacactaaa
gaatgtaatggtattggtaaagttaaatcattattgaacgaaataagagaagatattggt
tcaaaaactaaagatatcgaagattgtgaaatgcatgttcaccatgaaggacaatatatc
acgtttcatcgtactgatgttaaatcaggtgcaggttattatttgattgcaagaaccaaa
ttttatgacgccggtgagcaaaagcttccaccagtaattcttaacgattcacaatgtaaa
ttgaagtttgcgtattccttagaaaaggtcggtgatgtacctaattcaaaggaatttatt
aaaggaattcccacgaaactaagagaattaactgattttgaggttaaatatgataaaaat
tcgagaagttccacaattattgttcccgaagacttcccacaaggttcaattgcagttttt
gaaacccaacagaatggtgtagacacatggttggatcatttcttgagaagtggtgctcta
agtgctacgagaaacgtcactttggaatcattaaattgcatattatatcgtgccgaatct
gaagaacttgaatctagtgcaggtaagaatggagcctatgatattcctgacttcgggaag
ttggtgtactgtgggttacagggttggattaccatccttcaagatattgttttcaataac
gacttggcacatcctttaagtgcaaatcttcgtaatggtcattgggcattagattataca
gtggataggctagacctttataaggaccaacccggtgttgaagatattcaagaatggttg
cgtagtaggttcgataagatcaagaaattgccatactatttgaccccaagttatttcgct
cttattattggtgtcctatatggatgttgtcgtttaagagcaatgcaattaatgtcggaa
aacattggtaaatctactgtttttgttcagagtttggccatgacctcaattcaaatggtt
tccaagatgaaatctacttctattttaccatttgaaaatgttccagcaatggctgcgggc
cttcctcatttcagtactgattatatgagatgttggggtagggatgtgtttatttcctta
agagggttattattgactactggtaggtttgaccaagctaaaagtcacattttagcgttt
gcaaaaactttaaaacatggtttgattcctaatttgttggatgctggtagaaaccctaga
tataatgctcgtgatgcagcatggttctttactcaatccattcaagattatgcaactatt
gttccaaatggtacagatattttgaaggaagaaattactagaagatttccaaaggacgat
acatatgttgctttggacgattctagagcatttagcgaaactagttcacttgaagatatt
ctttatgaaatcttgagtcgtcatgcgagaggcattaaatatagagaagccaatgctggt
cccaacttggatagagtcatgactgacaagggatttgatgtggaagttcatgttgattgg
tcaactgggttaatacacggtggctcaccatacaactgtgggacatggatggataagatg
ggtgagagtgaaaaggctcattccgtaggtgtcccaggtactccaagagatggtgctgcg
gttgagatcaatggtttattgaagagttgtttaagatttgtgatcgatttgaataagcaa
gggaaatttaaatacactgacgtggttaaacaggatggtgagaaaatatcgttagaagct
tggaatgacttgcttcaagaaaattttgaaaagaaattctacgttccaaaagatcctgct
caagataagttttatgatattcttcctaacgtcgttaacaggagaggtatttacaaagat
ctttacaagtctagtaagccatatgaagactatcaattaagacctaattttgctattgcc
atgaccgttgctccagaattattcacacctgaatatgctacatttgcgattaatatagcc
gatacggtacttaagggccctgttggtatgcgtaccctagatcctagtgattataactat
cgtccatattatatcaacagtgaggattctgaagattttgccacatccaagggtagaaac
taccatcaaggtcctgaatgggtttggtgttacggttacttcttaagagcatttcactat
ttcaatttccatactaatatccgttgccaaaatgaaccaaaggataaaccatcctcatat
ctttaccaacaattatataacagattggcaggtcacagagaatggctaaaaaatagtgaa
tggcgtggcttgacagagctaactaataaggatggagaaatttgtaacgattctagtcca
acacaggcatggagttcaggatgtctcttagatgttttctatgatctttggagtgcctat
gaatga

DBGET integrated database retrieval system