KEGG   Naumovozyma castellii: NCAS_0B00550Help
Entry
NCAS_0B00550      CDS       T02233                                 

Gene name
NCAS0B00550
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ncs  Naumovozyma castellii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ncs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:83128..83976
Genome map
AA seq 282 aa AA seqDB search
MTNEPERSNNSKKLMSGSNKRIIFLKNKTINHDKYEIEFLSHGYDPVFIPLIEHTNIPNE
ALTLLKEKEYISSVNFIIITSQRTVECLNECILPVLDAEHKSLLLNKVIYTVGPATAEYL
QQSGFKNIRGGKEAGNGNILADIIISDLQHSTEDFLLKNHGPILFFVGQIRKDIILKKLS
KSDISIREVVVYDTKELQDNVIRFQECVKNSVTNYVVVFSPQGMNEIVDYLKDQPNSSKF
RIASIGPTTKKYLEEKGLSNVIVSPKPDAVSLLNEIEMHPLK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaccagaacgatcgaacaattcaaagaaattaatgtctggctccaacaag
aggatcatatttcttaagaataagactatcaatcatgataagtatgaaattgagtttcta
tctcatggatatgaccccgttttcataccgttgattgagcataccaatatacctaatgaa
gctttgacattattaaaggaaaaggagtacatttccagcgtcaatttcattataataacg
tcccaaagaacggtagaatgtttgaatgaatgtattttgcctgtcttggatgcggaacat
aaatcactcctattgaacaaagtgatttatacagtagggcccgctacagcagaatattta
cagcaaagtgggtttaagaacattcgagggggtaaagaagctggaaatggaaacatattg
gcagacatcataattagtgatcttcaacattcaaccgaagattttcttcttaagaaccat
ggccctatcttattttttgttggtcaaatcagaaaagatattatcctcaaaaaattatca
aaaagtgacatatctattagggaggtagtagtgtatgatactaaggaacttcaagataat
gtcattcgatttcaagaatgtgttaaaaatagtgttacaaattatgttgttgtatttagc
ccccaaggtatgaatgaaattgtggattatcttaaagaccaaccaaattcttctaaattt
aggattgcatctattggtcctaccaccaaaaaatacttagaagagaaaggactatcaaat
gttattgttagtcctaaacctgatgctgtttcattactgaatgagattgaaatgcatccc
ttgaaatga

DBGET integrated database retrieval system