KEGG   Naumovozyma castellii: NCAS_0B00580Help
Entry
NCAS_0B00580      CDS       T02233                                 

Gene name
NCAS0B00580
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:86690..88090
Genome map
AA seq 466 aa AA seqDB search
MGDHCKHIEQVFQNEKSKDGVLKSCNAARFILRHTPIKEKLLHTMKCSQCQEINAGSTFM
CLQCDFVGCWNGSHFITHMKRFGHVFGINSSNGLLFCFKCMDYIGHLETINYSMLNKYWD
DISTKTTIPSQERRDGLFGLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNS
SLCMSCALDAMIIEFYGQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKINENFAGYS
QQDAHEFLQYFLNQLHQDYKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSKTI
IDPFMDLSLDIKDKTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLPPMLV
LQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIYELTGILSHIGSINE
GHYVVVLKINDGRWFKFNDSMISVIKEDEALKQQAYLLFYTVRQIN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcattgcaaacatatcgaacaagtcttccaaaatgaaaaatcgaaggatggg
gtcctgaaatcctgcaatgcagccagattcatcctgagacacacgcccatcaaggagaaa
ttattgcataccatgaagtgttctcaatgtcaggaaatcaatgccggttccacttttatg
tgcctacaatgtgactttgtcggttgttggaatgggtcccattttataactcacatgaaa
cgattcggccatgtcttcggtattaattcatccaatggacttttattttgtttcaagtgt
atggactatatcggtcatttggaaaccataaattactccatgttgaacaaatattgggat
gacatttccacgaagacaacgataccgtctcaggaacgaagagatggactttttgggttg
gtcaacatggggtctacatgctttatgagtagtatattgcaagctttgatacataatcca
tacattgtcaattattccatgagtcaaactcattttgtgaattgttccattaaaaattca
tccttgtgtatgtcatgtgccctagacgccatgattatagaattttatggtcaaagcaaa
ttgcaacctatatcctcctcatcatcatcatcctcatcctcgtcgtcatcatcaccatct
gcatttatttctttgttgacctgttcattgaagatcaatgagaattttgcaggttattca
caacaagacgctcatgaattcctacaatattttttaaatcaattgcatcaagactacaag
agagattcttctcataatgaacaagagaataattgtccctgtgtagcacattcaatcttc
caaggagaattgaagagttccattgtttgtcctgaatgtcaaaatgattccaagaccata
attgatcccttcatggatttatcattagatattaaagacaagacagatttgtatcaatgt
ttggatagtttccataagaaggagaagcttcatgatttcaactaccattgttctcgatgt
aatacttccttggatccgataaagcaatttaccattaataaattaccaccaatgcttgtg
ttacaactgaaaagatttgaacatttcgttaatggaaccaatgtcaaattaaatgaattt
gttcaatacccattgtatttaaatatgcgagactattgtgataggaatacaaaccaggaa
actcccgatattatttacgaattaaccggtatattatctcatattgggtccattaatgaa
ggtcattatgtggtagtgttaaagataaatgatggaaggtggtttaaatttaatgattcc
atgatctctgtcatcaaagaagacgaggcactaaaacaacaagcatacttattattctac
acagttcgtcaaattaattaa

DBGET integrated database retrieval system