KEGG   Naumovozyma castellii: NCAS_0B00640Help
Entry
NCAS_0B00640      CDS       T02233                                 

Gene name
NCAS0B00640
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ncs  Naumovozyma castellii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCAS_0B00640 (NCAS0B00640)
Enzymes [BR:ncs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCAS_0B00640 (NCAS0B00640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(92384..93331)
Genome map
AA seq 315 aa AA seqDB search
MKLLVLLICVFQAFVHCQNFYDADPNIIELTPANFDKVVHRTNYTTLIEFYAPWCGYCKQ
LKGTIHKAARKLKGVVQVATVNCDLEQNKQLCGQYGIEGFPTLKIFKPPRVNLKKRGPTR
FKTHADELYNGQRNLAPIVDFALSRIKTYVKKLGRVDKLQNVLDNSTRPSVVLFSKKGPI
SPIYKSIAIDWLGQVDLYTMPNVKMETLNNLDAFSQSYPKIATFLESFVKTQSSNDKSRL
VVFNGVDDTYFEFDGESITKKDVAQFLTNSLNITPKEGPLSSREAYLETLRSGKKKKKNT
KKSKSSSSSRKRDEL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattggtattactcatttgtgtattccaggcttttgttcactgtcagaatttc
tacgatgcagatcccaacattatcgaattaacacctgctaatttcgataaggtggttcat
cgaactaattatactacgttgattgaattctatgctccatggtgtggttactgtaaacaa
ttgaagggtaccatccacaaggctgccaggaaattgaaaggcgtagtacaagtcgctact
gttaattgtgatctcgaacaaaacaagcagctctgtggacaatatggaatagaaggtttc
ccaactttaaaaatatttaaacctcccagagtcaaccttaagaagaggggtccaactaga
ttcaagacacatgcagatgaactttacaacggtcaaagaaatttagctcccattgtagat
tttgccttatccagaattaagacatacgtaaagaaattgggccgagtggataagttacaa
aatgtgttggataattccacaagaccctctgtggttttattctcgaagaagggtcccatt
tcgcccatttataagagtattgccattgattggttgggtcaagtggatttgtacactatg
cctaacgtgaagatggaaacgttaaataatttggacgcattttctcaatcttatcctaag
attgctacgtttttggaaagttttgttaagactcaaagctcgaatgacaagagtcgacta
gttgtgttcaacggggtggatgacacatattttgagtttgatggagaatcaataacaaag
aaggatgtagcccaattcttgaccaattctcttaacataacaccaaaagagggacctctg
agttcccgtgaggcgtatttagagaccttacggagtggtaagaagaagaaaaaaaataca
aagaagtccaagagctcttcatcttcaagaaaacgtgatgaattgtga

DBGET integrated database retrieval system