KEGG   Naumovozyma castellii: NCAS_0B02050Help
Entry
NCAS_0B02050      CDS       T02233                                 

Gene name
NCAS0B02050
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCAS_0B02050 (NCAS0B02050)
Transfer RNA biogenesis [BR:ncs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NCAS_0B02050 (NCAS0B02050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(336312..337997)
Genome map
AA seq 561 aa AA seqDB search
MGRHGKGPKTNKQNLAPEKERFIQCCSDITLELTNSLTSNTTREINLNGLITKYSKKYKL
KQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYIVMG
GTFMSLPNDYREDFITKLHNALSGFNGNDLDEAIKYSQQSLTKCVGITIETRPDYCTETH
LDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVSEIFALSKDAGYKVVAHMMPDLPN
VGMERDIEQFKEYFENPGFRTDGLKIYPTLVIRGTGLYELWKSGKYKSYNANALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGISCRDIRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKATKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKIAVISGVGVRNY
YAKLGYELDGPYMSKIITPAF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcacggtaagggtcccaagaccaataagcaaaatttagctccagaaaaggaa
cgttttatccaatgttgttccgacatcacattggaattgactaactctttaacttccaac
acaacgagagaaatcaacttaaatggtctgattactaaatactccaagaaatataagttg
aaacaacagccaaggcttacggatattatcaactctattccggaccaatacaagaaatac
ttacttcctaaattgaaggccaaaccagtgcgtactgcatctggtatcgctgttgttgcc
gtgatgtgtaaaccacatcgttgtcctcatattgcatacacaggtaacatttgtgtctat
tgtcctggtggcccagattctgattttgaatattcaacccaatcatatacaggttatgaa
ccaacgtccatgcgtgccattagggctcgttacgatccatatgaacaagcaagaggtaga
gtagaacaattgaaacaattgggtcattccattgataaggttgaatatattgtcatgggt
ggtacgtttatgtctttacctaatgattatagagaagattttattactaaattgcataac
gctttatctgggtttaatgggaatgatcttgatgaagccattaaatattcacaacaaagt
ttgactaaatgtgtaggtatcactattgagacgagacctgattattgtactgagactcat
ttggatgatatgttgagatatggttgtactagattggaaatcggtgtccaatcactatac
gaagatgtcgctagagacacgaatagaggacataccgtgaaggctgtctctgaaattttt
gcattatctaaggatgctggttacaaagttgttgctcacatgatgcccgatttacctaac
gttgggatggaaagagatattgaacaatttaaagaatattttgaaaatccagggtttaga
actgatggtttgaaaatctatcctactttggttattagaggtactgggttatatgaactt
tggaaatcaggtaaatataaatcttataatgctaatgccttagtcgatttggtggccaga
attatggctttagtgccaccttggacaagaatttatcgtgttcaaagagatattccaatg
ccgttagtcacctctggtgtggacaatggtaatttaagagaactagcattggctagaatg
aaagatcttggtatttcatgtagagatatacgtacaagggaagtgggtattcaagaagtc
catcataaagttcaacctgatcaagtggagttaattagaagagattactatgctaatggt
ggttgggaaactttcttgtcatatgaagatccaaagaaagatattcttattgggttattg
agattgagaaaggccactaagaaatatacatatagaaaggaattcacgtcccaaagaaca
tctattgtcagagaactgcacgtttatggttctgtagttccgttacattccagagatcca
cgtaagtttcaacatcaaggttttggtacgctgctaatggaagaagctgagcggattgcc
cgtgaagagcatggttccgagaagattgctgttatctccggtgttggtgtgagaaattat
tatgccaaattgggttatgaattggatggaccatatatgtctaagataataactcctgca
ttttaa

DBGET integrated database retrieval system