KEGG   Naumovozyma castellii: NCAS_0B02050Help
Entry
NCAS_0B02050      CDS       T02233                                 

Gene name
NCAS0B02050
Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCAS_0B02050 (NCAS0B02050)
Transfer RNA biogenesis [BR:ncs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NCAS_0B02050 (NCAS0B02050)
Chromosome and associated proteins [BR:ncs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    NCAS_0B02050 (NCAS0B02050)
   HAT complexes
    Elongator complex
     NCAS_0B02050 (NCAS0B02050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 11526311
NCBI-ProteinID: XP_003674663
UniProt: G0VBG3
Position
2:complement(336312..337997)
Genome map
AA seq 561 aa AA seqDB search
MGRHGKGPKTNKQNLAPEKERFIQCCSDITLELTNSLTSNTTREINLNGLITKYSKKYKL
KQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYIVMG
GTFMSLPNDYREDFITKLHNALSGFNGNDLDEAIKYSQQSLTKCVGITIETRPDYCTETH
LDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVSEIFALSKDAGYKVVAHMMPDLPN
VGMERDIEQFKEYFENPGFRTDGLKIYPTLVIRGTGLYELWKSGKYKSYNANALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGISCRDIRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKATKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKIAVISGVGVRNY
YAKLGYELDGPYMSKIITPAF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcacggtaagggtcccaagaccaataagcaaaatttagctccagaaaaggaa
cgttttatccaatgttgttccgacatcacattggaattgactaactctttaacttccaac
acaacgagagaaatcaacttaaatggtctgattactaaatactccaagaaatataagttg
aaacaacagccaaggcttacggatattatcaactctattccggaccaatacaagaaatac
ttacttcctaaattgaaggccaaaccagtgcgtactgcatctggtatcgctgttgttgcc
gtgatgtgtaaaccacatcgttgtcctcatattgcatacacaggtaacatttgtgtctat
tgtcctggtggcccagattctgattttgaatattcaacccaatcatatacaggttatgaa
ccaacgtccatgcgtgccattagggctcgttacgatccatatgaacaagcaagaggtaga
gtagaacaattgaaacaattgggtcattccattgataaggttgaatatattgtcatgggt
ggtacgtttatgtctttacctaatgattatagagaagattttattactaaattgcataac
gctttatctgggtttaatgggaatgatcttgatgaagccattaaatattcacaacaaagt
ttgactaaatgtgtaggtatcactattgagacgagacctgattattgtactgagactcat
ttggatgatatgttgagatatggttgtactagattggaaatcggtgtccaatcactatac
gaagatgtcgctagagacacgaatagaggacataccgtgaaggctgtctctgaaattttt
gcattatctaaggatgctggttacaaagttgttgctcacatgatgcccgatttacctaac
gttgggatggaaagagatattgaacaatttaaagaatattttgaaaatccagggtttaga
actgatggtttgaaaatctatcctactttggttattagaggtactgggttatatgaactt
tggaaatcaggtaaatataaatcttataatgctaatgccttagtcgatttggtggccaga
attatggctttagtgccaccttggacaagaatttatcgtgttcaaagagatattccaatg
ccgttagtcacctctggtgtggacaatggtaatttaagagaactagcattggctagaatg
aaagatcttggtatttcatgtagagatatacgtacaagggaagtgggtattcaagaagtc
catcataaagttcaacctgatcaagtggagttaattagaagagattactatgctaatggt
ggttgggaaactttcttgtcatatgaagatccaaagaaagatattcttattgggttattg
agattgagaaaggccactaagaaatatacatatagaaaggaattcacgtcccaaagaaca
tctattgtcagagaactgcacgtttatggttctgtagttccgttacattccagagatcca
cgtaagtttcaacatcaaggttttggtacgctgctaatggaagaagctgagcggattgcc
cgtgaagagcatggttccgagaagattgctgttatctccggtgttggtgtgagaaattat
tatgccaaattgggttatgaattggatggaccatatatgtctaagataataactcctgca
ttttaa

DBGET integrated database retrieval system