KEGG   Naumovozyma castellii: NCAS_0B02430Help
Entry
NCAS_0B02430      CDS       T02233                                 

Gene name
NCAS0B02430
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCAS_0B02430 (NCAS0B02430)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCAS_0B02430 (NCAS0B02430)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCAS_0B02430 (NCAS0B02430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:406422..408059
Genome map
AA seq 545 aa AA seqDB search
MALKMSSNSYEHASLLQHPKRKQKRILPTTIVLIILTFIIYRLTSNNNEPFFEAKSKKKN
VIFFVSDGMGPASLSLTRSFRQYSQNLTIDDILTLDKHLIGTSRTRSSDSLITDSAAGAT
AFSCALKTYNSACGIDSNKNPCGTLLEAAHLDGLLTGMVVTTRITDATPAAFSSHVDYRF
QEDLIAEHQLGYYPLGRSVDLIIGGGRTHFYSTAPGGSRKDGRNLIEEAIDDGWQYVGNR
EQFDQLQMGKNVSLPLLALLADGDIPFDLDRDDTKYPSLEEQTLTALKALSEATEDSDKG
FFLLVEGSRIDHAGHQNDPSAQVREVLAFDKAFNSALEFINDLDTETIILSTSDHETGGL
VTARQVTKEYPDYVWYPSYLNNAKHSGEFLKSTVLSYNAEEHTMNEKEDFVRYEILENFL
GIHDYQEEDVKELATMTNPIDIQRKINYMISYRAQIGWTTEGHSAVDVYIYGYSNRKTSW
LQILENLQGNHENIEIGQFIKNYLKLDLDKVTKLVKDTDHSPKLSTKEVEELPLFDEYMH
QLKNN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaagatgtccagtaattcatacgaacatgcctctttgcttcaacatccaaaa
aggaagcagaagagaattctaccaactaccatcgttttgatcattttgacgtttatcatt
tacagattaacatcaaataataatgaaccatttttcgaggccaaatcaaagaagaaaaat
gtcatattctttgtttctgatggtatgggtccagcatctctctcattgacaagatcattt
agacagtactcccaaaatctaactatagatgacattttaactttagacaagcatttaata
ggcacatcaagaacacgttcttcagattctttaatcactgactcggctgcaggtgccact
gcattttcttgtgcattgaagacttataacagtgcatgtgggattgactctaataaaaac
ccatgcggaacccttttagaagctgcacatcttgacggtttattaactgggatggtggtc
acaaccagaattactgatgctacaccggctgcattttcatctcatgtagattatagattt
caggaagatttaatcgctgagcatcaattagggtactatcctttgggaagaagtgtggat
ttaatcatcggtggtggtagaactcatttctactcaactgcccccgggggaagtagaaag
gatgggagaaacttgattgaggaagccatcgatgatggctggcaatacgtgggaaaccgt
gaacaattcgatcaattacaaatgggtaagaatgtaagtttaccattgttggcactatta
gccgatggtgatatcccatttgaccttgatagagatgacactaagtatccatctttggaa
gaacaaacattaacagcattgaaggcattaagtgaagcaactgaggattcagataaaggg
tttttcttgttagtagaaggttcaagaatcgatcatgcaggacatcaaaatgatccttca
gcccaagtaagagaagtgttagcctttgacaaagcattcaattctgcattagaatttatt
aatgatttagacactgaaacaatcatattatctacttcagaccatgaaactggtggatta
gtcactgccagacaagtcacgaaagagtatccagattatgtgtggtaccctagctacttg
aataatgccaaacattctggtgaattcttgaaatcaactgtgttatcctacaatgcggaa
gaacacaccatgaatgaaaaagaggattttgttagatatgagatattggaaaatttttta
ggcatacatgattaccaagaggaagatgtcaaagaattggcaacaatgacaaatccaatt
gatattcaaaggaagataaactatatgatttcatatagggctcaaattggttggactact
gagggtcatagcgcagtcgatgtttatatctacgggtattccaatagaaaaacttcttgg
ttacagattctggaaaatctacaaggtaatcatgaaaatattgaaattggccaattcatt
aagaactatttgaagttagatttagataaggttactaaattggttaaagatacggatcat
tcaccaaagttatcaaccaaggaagtcgaagagcttcctttgttcgatgagtatatgcac
cagcttaaaaacaactga

DBGET integrated database retrieval system