KEGG   Naumovozyma castellii: NCAS_0B02760Help
Entry
NCAS_0B02760      CDS       T02233                                 

Gene name
NCAS0B02760
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ncs  Naumovozyma castellii
Brite
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCAS_0B02760 (NCAS0B02760)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:468584..468973
Genome map
AA seq 129 aa AA seqDB search
MSASKKPASKAPAEKKPVAKKTSTGGDIKKRTKARKETYSSYIYKVLKQTHPDTGISQKS
MSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAV
TKYSSSTQA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcaaagaaacctgcttccaaagccccagctgaaaagaaaccagttgctaag
aaaacttctactggtggtgacatcaagaagagaacaaaggctagaaaggaaacttactcc
tcatacatttacaaggttttgaaacaaacacatccagacaccggtatttctcaaaaatct
atgtctattttgaactctttcgttaacgatatctttgaaagaatcgccactgaagcttct
aaattggctgcttacaacaagaaatctaccatatcagcaagagaaattcaaaccgctgtt
agattaatcctacctggtgaattagctaaacatgctgtctctgaaggtactagagcagtt
accaaatattcttcctctactcaagcttaa

DBGET integrated database retrieval system