KEGG   Naumovozyma castellii: NCAS_0B03240Help
Entry
NCAS_0B03240      CDS       T02233                                 

Gene name
NCAS0B03240
Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00620  Pyruvate metabolism
ncs00640  Propanoate metabolism
ncs00680  Methane metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0B03240 (NCAS0B03240)
   00620 Pyruvate metabolism
    NCAS_0B03240 (NCAS0B03240)
   00640 Propanoate metabolism
    NCAS_0B03240 (NCAS0B03240)
  Energy metabolism
   00680 Methane metabolism
    NCAS_0B03240 (NCAS0B03240)
Enzymes [BR:ncs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NCAS_0B03240 (NCAS0B03240)
Lipid biosynthesis proteins [BR:ncs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NCAS_0B03240 (NCAS0B03240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 11525891
NCBI-ProteinID: XP_003674782
UniProt: G0VBT2
Position
2:565690..567741
Genome map
AA seq 683 aa AA seqDB search
MSIKEHKVVHEAQNVEVRHAPEHFYKSQPGAGYVTDMNHYQQLYDQSINDPETFFGEKAK
EFLDWDKPFTKVQSGSLDNGDVAWFLNGELNASYNCVDRHAFADPSKPAIIYEADDEKDN
RVITFGDLLRQVSEVAGVLKSWGVKKGDTVGVYLPMIPEAVVAMLAIARLGAIHSVIFAG
FSAGSLKDRVVDAGCKVVITCDQGKRGGKTVHTKKIVDEGLNGVDSVSHILVFQRTGSEG
IQMKAGRDFWWHEEIVRQRGYFPPVPCNAEDPLFLLYTSGSTGTPKGVVHSTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTATIIFESTPAYPDYGRYWRII
ERHKATHFYVAPTALRLIKRVGEEEISKYDISSLRVLGSVGEPISPDLWEWYHEKIGNKN
CVVCDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGIDAAIIDPVTGVELKGNDVEGVL
AVKSPWPSMARSIWNNHIHYINTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEAALGNNDHVSEAAVVGITDELTGQAVVAFVSLKKDFAQDNATEGDFLHATP
DDLRRELILQVRGEIGPFAAPKSIILVRDLPKTRSGKIMRRVLRKVASNEADQLGDLSTL
ANADIVPSIISAVETQFLATKKK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaaagaacataaagtggtgcacgaagcccaaaacgtcgaagttcgtcatgct
ccagaacatttctacaagagtcagcctggtgctggttatgttactgatatgaaccattac
caacaattatatgaccaatcaatcaatgacccagagacttttttcggtgaaaaggccaag
gaatttttggactgggataagccatttaccaaggtccaatcaggatccctagacaatggt
gatgttgcctggtttttgaacggtgaattgaatgcctcttacaattgtgtcgacagacat
gcattcgccgatccatccaagccagctatcatctacgaagccgatgacgaaaaggacaac
agagttattacttttggtgatttattaagacaagtttccgaagttgctggtgtcctgaaa
agctggggtgtcaagaagggtgataccgttggtgtttacttaccgatgattcctgaagca
gtggtcgcaatgcttgccattgctcgtctaggtgccatccattccgtcatctttgccggg
ttttcagcaggttctttgaaagatcgtgttgttgatgccggttgtaaagttgtcatcact
tgtgatcaaggtaagagaggtggtaagaccgttcatactaagaagatcgtcgatgaaggt
ttaaacggtgtggattcagtctctcacatcttggtgttccaaagaactggttctgaaggc
attcaaatgaaagctggaagggatttctggtggcacgaagaaattgttaggcaaagaggt
tatttcccacctgttccatgtaatgcagaagatcctcttttcttactatacacatcgggt
tcaacaggtacccccaagggtgtcgtacattccacaggtggttatttactaggggctgcc
ttgacaactagatatgtctttgatatccatccagaagatgttctattcacagcaggggac
gtgggttggattactggtcacacatacgccctttacggtccattaactcttggtaccgct
accattatcttcgaatccacaccagcttacccagattacggtagatactggagaatcatc
gaacgtcataaggctactcatttctatgtggctccaactgcattaagattgatcaaacgt
gttggtgaagaagaaatttctaaatatgacatttcatcattacgtgtcttaggttctgtc
ggtgaaccaatttctcccgatctatgggaatggtatcatgaaaagattggtaacaagaat
tgtgtagtctgtgataccatgtggcaaactgaatctgggtcacatttgattgcaccatta
gctggtgctgtacccaccaaacctggttcagccactgttccattctttggtatcgatgca
gcaatcattgatccagtaacaggtgtagaattgaagggtaacgacgttgaaggtgtcctt
gctgtgaagtctccatggccatccatggctagatccatctggaacaatcatattcattat
atcaacacatacttgaaaccatacccaggttattatttcacaggtgatggtgccggaaga
gatcatgatggttactactggatcagaggtagagtcgatgatgtggtgaatgtttctggt
cacagattatcaactgctgaaattgaagctgcattgggcaataacgaccacgtgtctgaa
gctgccgttgttggtattactgatgaattgactggtcaagccgttgtcgccttcgtttct
ttaaagaaagatttcgctcaagacaacgctacagaaggtgatttcttacatgccactcct
gatgacttacgtcgtgagttgattctacaagtgagaggggaaattggtccctttgctgca
ccaaagagtattatcctagtgagagatttacctaagacaagatctggtaagatcatgaga
agagtgctaagaaaggttgcatctaacgaagctgatcaattgggagacctatcaacttta
gcgaatgctgatattgtcccatccatcatatccgcagtggaaacccaatttctagcgacc
aagaagaaataa

DBGET integrated database retrieval system