KEGG   Naumovozyma castellii: NCAS_0B03610Help
Entry
NCAS_0B03610      CDS       T02233                                 

Gene name
NCAS0B03610
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCAS_0B03610 (NCAS0B03610)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCAS_0B03610 (NCAS0B03610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:640052..641323
Genome map
AA seq 423 aa AA seqDB search
MKSNPTVSDYGEHIGLDKDDHLSDASLGLSYVNEFIDTTSNEIEIKSTVLRIIEQLDLGK
GKNGKTSLEDLTLIHLKGALTNVIYKVEIVGCTSLLLRIFGDKKESAVDRIYEMETLHRL
KLASINGPQVLGIFKNGRVEAFFEGFKSCEREEVRDLEISKVIAMRFKKLHSKVILRGKE
TEPICWTTIDKWLHIFETTGEKWIENDKNIKQMFLCNNWAYFKEHIFKYKEWILGFETGK
ELKFCHNDLQQGNIIHLSQRERNEEAFLKSIMMIDYEYAGPNIPEYDLSNHLTEWIHDYN
TEESYKCNGSKYPDKAQIFSFIYSYLDYLPNDNGENRLEVATDMYQSIWRWRACGQLFWS
LWAVLQSGVLVDHVDDKTEADSFNYLKFCQEKMSFFWGDLIQYQIASASDLADYNVRYLG
ECI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaacccaactgtgtcagattatggagaacatataggattggataaagatgat
cacttgagtgatgcatcgctgggactctcatatgttaatgagttcatagatacgacgagc
aatgagatagaaattaaatcaaccgttttacgtataatcgagcaattagaccttggaaag
ggaaaaaatgggaagacttctcttgaagatcttactttaattcatctcaaaggtgctttg
actaacgtgatttataaagtggaaattgttggatgcacatctttgctacttcggatcttt
ggagataagaaggagtcagcagtagatagaatatatgaaatggagacccttcataggttg
aagttagccagtataaatgggccgcaagtgttagggatctttaagaatgggagagtggag
gccttttttgaggggtttaagagctgtgaaagggaagaggtcagagatctcgaaatatct
aaggtcattgctatgagatttaagaagttgcattcaaaagtaatcttacgaggaaaagaa
actgaacctatatgttggacaacaattgacaagtggttacatatatttgaaaccacgggc
gagaaatggattgagaatgacaagaacataaaacaaatgtttctatgcaacaattgggcg
tatttcaaggagcatatcttcaagtataaggagtggatattagggtttgaaacgggtaaa
gaactaaaattttgtcacaatgatttacagcagggcaacatcattcatctttcacaacga
gaacgtaatgaagaagctttcttaaaaagcataatgatgattgattatgaatatgcaggt
ccaaatattccagaatatgacttgtccaatcatttgacagaatggattcatgattacaac
acagaggaatcatacaagtgtaatggttcgaaatatccagataaagcacagattttttcg
tttatttattcatatttagattacctccccaatgataatggtgaaaatcgtcttgaagta
gcaacagacatgtatcaatcgatatggagatggagggcatgtggacaattattttggtca
ctttgggcagtcttacaaagtggcgtgcttgtcgatcacgtcgatgataagacagaggca
gattcctttaactacttgaagttttgtcaggagaagatgagtttcttttggggtgatttg
atccaataccaaattgcatctgcctcagacttggcagattataatgtacgataccttggt
gaatgcatatag

DBGET integrated database retrieval system