KEGG   Naumovozyma castellii: NCAS_0B03620Help
Entry
NCAS_0B03620      CDS       T02233                                 

Gene name
NCAS0B03620
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ncs  Naumovozyma castellii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCAS_0B03620 (NCAS0B03620)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCAS_0B03620 (NCAS0B03620)
  Amino acid metabolism
   00310 Lysine degradation
    NCAS_0B03620 (NCAS0B03620)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NCAS_0B03620 (NCAS0B03620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(641446..642774)
Genome map
AA seq 442 aa AA seqDB search
MLSRSTRRFAPKILQSASRNFSKQTSTRLLRQNPAASILQTPSSPHVSFQKLTNFTLAQR
WASTSVKVPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETDKIDIEVIAPVSGTVSKL
NFKPEDTVTVGEELATIEEGEGSASKSEAETPAPAASENTADAAPAKEEAKPAAEAKKEK
AASKPSPTPTKPASKPKEEPKMAKPSFTSFSRNETRVKMNRMRMRIAERLKESQNTAASL
TTFNEVDMSSLLEMRKLYKDEIIKSQGVKFGFMGLFSKACVIAAKEFPGVNGAIEGDQIV
YRDYVDISVAVATPKGLVTPVIRNVESLSVLEIEQEIVNMSKKARDGKLTLEDMTGGTFT
ISNGGVFGSLFGTPIINTPQTAVLGLHGVKEKPVSINGQIVSRPMMYLALTYDHRLLDGR
EAVTFLKNVKELIEDPRKMTLF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctctccagatcaactcgcagattcgcaccaaagatactccaatcggcatcgagaaac
ttctccaaacaaacatcaacaagactgctaagacagaacccggcagcttccatattgcaa
acaccctcatcaccacatgtatcatttcaaaaattgacaaatttcactttggctcaacgt
tgggcctccacttcagtgaaagttcctcaaatggctgaatcattgacagagggatctcta
aaggaattcaccaaggctgtcggtgatttcatcgagcaagatgaattgctggccaccatc
gagacagataagatcgatattgaagtcatcgctccagtatcaggtactgtctccaaatta
aattttaaaccggaggatactgtcactgtcggtgaagaattggctaccattgaagaaggt
gaaggatctgcttctaagtctgaagctgaaacaccagctcctgctgcatctgaaaatact
gccgacgccgctccagcaaaggaagaagccaaaccggctgctgaagctaaaaaggaaaag
gctgcttcaaaaccttctcctaccccaacaaaacctgctagtaaaccaaaggaagaacct
aaaatggcaaaaccttcatttacttccttttctcgtaatgaaacaagagtgaaaatgaat
agaatgagaatgagaattgccgaaagattaaaggaatctcaaaatacagcagcttcattg
accactttcaatgaagtagatatgtcctctttattggaaatgaggaaactatacaaggat
gaaataattaaatcccaaggtgtcaaattcggtttcatgggtcttttctccaaagcctgt
gttatcgctgccaaggagttcccaggtgtcaacggagccattgaaggtgatcaaattgtt
tatagagattacgtcgatatttctgtcgccgtggcaactccaaaggggttagtcactcca
gtcattcgtaacgtggaatctctctccgtgttagaaattgaacaagaaattgtaaatatg
agtaagaaggctcgtgatgggaaattaactttggaagatatgactggtggtacttttaca
atttctaatggtggtgtctttggttcattatttggtactccaattattaatacgcctcaa
accgcagtcttaggtttacatggtgtcaaggaaaaaccagtaagtataaatggacaaatc
gtatcaagaccaatgatgtatttggcattgacatatgatcatagattactggatggtaga
gaagctgtaactttcttgaagaacgttaaggaattgatcgaagatccaagaaagatgaca
ttgttctaa

DBGET integrated database retrieval system