KEGG   Naumovozyma castellii: NCAS_0B04280Help
Entry
NCAS_0B04280      CDS       T02233                                 

Gene name
NCAS0B04280
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ncs  Naumovozyma castellii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCAS_0B04280 (NCAS0B04280)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCAS_0B04280 (NCAS0B04280)
Peptidases [BR:ncs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCAS_0B04280 (NCAS0B04280)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:777104..779872
Genome map
AA seq 922 aa AA seqDB search
MTLNNGSQKHCSSIQDLTQVAENFTNKKEQNGKDMGALLEECIDLLSNYKKECKQIKSAR
VEYNGKEDDSFKLFESAYVYYKIIHLIILSKIPNLNEFKSIKGNERKKSKDQELMQIYNT
LVNTLLNDDMISDIKAHIKENSLQKDTRKAKGKQELFSMKNGSLISSYQLKQLLYGKNDN
TSVLLIDIRPRLEFSKSHIKHEEIICVEPISFKDSYSDEEVAKKSLITSPNEEIDLFNKR
NEFEFIILYTNDKEKAYYNQQMVFLEILLTHSFAKPLDSWKTKVLILENGISSWSLNDGP
VESTRTNIPKDGETNANKDINKEDSVYINGNTSGLSLQTFPKAVPGISATMDNTMKDMMS
SSSSPDYSIRQKQQSPFIELKRTSSFKNFFSNFKSSSSADISKGTFTPSNHYSSPTSAID
LTPSASQINFNTQKSLYPEAPNLEKNETLTEVSYVSPLNQNIRPINARAVAPLSRSLSGS
TRGIPTGGIHQKEKFHAGMTLNGNSTDYNISKSEIFDSNNRSEMMPSSSLPPISPTKTGI
PNKSALHTNDKMLDLDFIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNS
KLGSKGVLAKYFARLIHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFC
QFLLDGLHEDLNQCGSNPPLKELSSAAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQ
GQYASRLQCEVCKHTSTTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWL
CPTCKKKQRSTKKLTITRLPRNLIIHLKRFDNNLNKNNNFIDYPFILDLTQFWVDDFDGK
LPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHGWYYFDDTNYRSI
KNKNEPITSSAYLLFYHRIYDL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgacactcaataatggttcacagaaacactgctcttcaatacaagacttgacacaagtt
gccgagaactttacaaataaaaaagaacaaaatggcaaggatatgggtgcattattagaa
gaatgtatagacctcttatcaaactataaaaaggaatgcaagcaaataaaatctgctaga
gtagaatataatgggaaggaagatgactcctttaagctattcgaaagtgcatacgtttat
tacaaaatcatccacctaatcattctttcgaaaatacctaacttaaacgaattcaaatcc
atcaaaggcaatgaaaggaagaaatccaaagatcaggagttaatgcaaatttataatact
cttgtgaacacgttgttaaacgatgatatgataagtgatattaaagctcatatcaaggaa
aattctttacagaaagatacacgaaaagcaaaaggcaaacaagaactgtttagcatgaag
aatggctcccttatttcctcatatcaactgaaacagttactatatggaaaaaatgataat
acatccgtacttttgatagacataaggcccagattagaattttcaaaatctcatattaaa
catgaggaaataatttgtgtcgaacctatatccttcaaggattcatactcagatgaagag
gttgcaaaaaaatccttaataacctcacctaatgaagaaatagatttgtttaacaagaga
aatgaatttgaattcataatattatatactaacgacaaagaaaaggcatattataatcaa
cagatggtttttttggaaattttgctaacgcattcgtttgcaaaaccgttagacagttgg
aaaactaaggttctcatcctggaaaacggtatttcatcctggtctttaaatgatggtcct
gtagaaagtacgagaactaatataccaaaagatggagagacaaacgctaacaaagacatt
aataaggaagatagcgtgtatataaacggcaatacatccggtctaagcctgcaaacgttc
ccaaaagcagttcccggtataagtgcaacaatggataatactatgaaagatatgatgtcg
tcgtcatcttcgcctgattattcaattcgacagaaacaacaatctcctttcatcgaatta
aaaagaacttcaagtttcaagaattttttttcgaattttaagtctagctcatctgctgat
atctccaaaggaacatttaccccttcaaatcattattcatcacctacctcggctattgac
ttgacaccttcggcatcccaaataaacttcaacacacaaaagtcactatacccagaggca
cctaatctagagaaaaatgaaacccttactgaggtgtcctatgtatctccgcttaatcaa
aatatcagaccaatcaacgcaagagcggtagcaccactctcaaggtcattgtcaggctca
acacgaggtataccgacgggaggtatacatcaaaaggaaaagtttcacgcaggaatgact
ttgaatggtaattcaaccgattataatatttctaaatcggaaatttttgatagcaacaac
agatcagaaatgatgccatcaagttcgctaccaccaatatcaccaaccaaaactggcata
ccaaataaaagcgctttacatactaatgataagatgctcgacctcgattttattgttggt
ttacagaatataggaaattcttgttatttgaactgcataatccaatgtcttttagggacc
catgaattaactaaaatattccttaataatttttacgagaggcatataaaccttaatagt
aaacttgggtctaagggtgttctagccaaatattttgctagattaattcatttaatgcat
aaccatgcaaacccaaagttgaagaacaactatgttaggccagctcaatttaaaatggct
gtaggctcagtcaacacattatttaaaaattgttcgcaacaggattgccaagaattttgt
cagttcttgttggatggcttacacgaagatttgaatcaatgtggctctaaccctccctta
aaggaactatcatccgctgcagaaaagaacagagagaaattatcattaagaatagcctcg
tctatcgaatgggagaggttcttgaccactgattttagtgttattgttgatctttttcag
gggcaatatgcttcaagattgcagtgcgaagtttgtaagcatacttcaacaacatatcag
ccattttctgtattatctgttcctatccccagggtgcctaaaggggtcaaggttaacatt
ttagattgcttcaaggattttaccaaactggaacttctcgatacagatgaacaatggctg
tgtccaacatgcaaaaaaaagcaacgctcaactaagaagttgaccataacaaggctgcca
agaaatctgataatccacctaaaaaggtttgataacaatttgaacaaaaataacaatttt
atcgattacccatttatattggatctaacacaattttgggtcgacgattttgatggtaag
ttacctcctggagtgagagatgagcttcccaaacgaggtcaaatcccaccctttaagtac
aaactctatggagtggcgtctcattttgggagtctctacggtggccattatacagcatac
gttgacaaaggacctaaacacggctggtattactttgatgatacaaattatcgttcaatt
aaaaataagaatgaacctattacatctagtgcttaccttctgttttatcaccgcatttat
gacctctga

DBGET integrated database retrieval system