KEGG   Naumovozyma castellii: NCAS_0B04450Help
Entry
NCAS_0B04450      CDS       T02233                                 

Gene name
NCAS0B04450
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ncs  Naumovozyma castellii
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ncs03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ncs04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(804348..805109,805378..805554))
Genome map
AA seq 312 aa AA seqDB search
MDQQAVDVDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQQGGRKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaagcagtcgatgtagataacattatcgatagattactagaagttcgaggc
tccaagccaggacaacaagtggatttggaagaacatgagattagatatctctgttccaag
gcaagatctattttcattaaacaaccaatcttattagaattggaagcaccaattaagatt
tgtggtgatattcacggtcaatattacgatttattgcgtctcttcgaatatggtggattt
ccaccagagtcaaactatttattcttaggtgattatgttgatcgtggtaaacaatcttta
gaaacaatttgtctgttacttgcttacaagattaaatatcctgaaaatttctttatctta
agaggtaatcacgaatgtgcctccattaatagaatttatgggttttatgatgaatgtaaa
agacgttataatatcaaactttggaaaactttcacagattgttttaactgtttgccaatt
gctgcaatcatcgacgaaaagatcttctgtatgcatggtgggttatcacctgatttaaat
agtatggaacaaattagaagagtcatgagaccaactgatatcccagatgtcggtttgtta
tgtgatttattatggtctgacccagataaagatattgtcggttggagtgaaaatgataga
ggtgtttcatttacttttggtcctgatgtcgttaatagatttttacaaaagcaagatatg
gaattgatttgtagagcacatcaagtcgtggaagatggttatgaattctttagtaagagg
caattagtaacgcttttcagtgctccaaattattgtggtgaattcgataatgccggtgca
atgatgagtgtggatgaaagtttgttatgttcattccaaattttgaaacctgcacaaaag
agtttgccaaggcaacaaggtggtagaaagaagaaataa

DBGET integrated database retrieval system